2OOQ - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE HUMAN RECEPTOR PHOSPHATASE PTPRT

Authors :   E. Ugochukwu, I. Alfano, A. Barr, T. Keates, J. Eswaran, E. Salah, P. Sav G. Bunkoczi, A. Edwards, C. H. Arrowsmith, J. Weigelt, M. Sundstrom, F Delft, S. Knapp, Structural Genomics Consortium (Sgc)

Date :   26 Jan 07 (Deposition) - 20 Feb 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Protein Tyrosine Phosphatase, Receptor, Human, Structural Genomics, Structural Genomics Consortium, Sgc, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. J. Barr, E. Ugochukwu, W. H. Lee, O. N. King, P. Filippakopoulos, I. Alfano, P. Savitsky, N. A. Burgess-Brown, S. Muller, S. Knapp
Large-Scale Structural Analysis Of The Classical Human Protein Tyrosine Phosphatome.
Cell(Cambridge, Mass. ) V. 136 352 2009
PubMed-ID: 19167335 | Reference-DOI: 10.1016/J.CELL.2008.11.038

Molecule 1 - RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE T
	Chains	:	A, B
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNIC28-BSA4
	Expression System Strain	:	BL21 ROSETTA (DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	PTPRT
	Gene	:	PTPRT, KIAA0283
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	R-PTP-T, RPTP-RHO

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 4)

No.	Name	Count	Type	Full Name
1	B3P	2	Ligand/Ion	2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
2	EDO	1	Ligand/Ion	1,2-ETHANEDIOL
3	NA	1	Ligand/Ion	SODIUM ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	B3P	1	Ligand/Ion	2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
2	EDO	-1	Ligand/Ion	1,2-ETHANEDIOL
3	NA	-1	Ligand/Ion	SODIUM ION

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	B3P	1	Ligand/Ion	2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
2	EDO	1	Ligand/Ion	1,2-ETHANEDIOL
3	NA	-1	Ligand/Ion	SODIUM ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS B:978 , ILE B:1102 , ASP B:1120	BINDING SITE FOR RESIDUE NA B 501
2	AC2	SOFTWARE	HOH A:86 , HOH A:294 , GLU A:1039 , GLU A:1041 , THR A:1050 , ARG A:1065	BINDING SITE FOR RESIDUE B3P A 301
3	AC3	SOFTWARE	GLU B:1039 , GLU B:1041 , THR B:1050 , ARG B:1065 , HOH B:1191 , HOH B:1256 , HOH B:1371 , HOH B:1390 , HOH B:1439 , HOH B:1441	BINDING SITE FOR RESIDUE B3P B 301
4	AC4	SOFTWARE	TRP B:1072 , GLY B:1076 , ARG B:1112 , GLN B:1154 , HOH B:1229 , HOH B:1301 , HOH B:1442	BINDING SITE FOR RESIDUE EDO B 502

(no "SS Bond" information available for 2OOQ)

(no "Cis Peptide Bond" information available for 2OOQ)

Asymmetric Unit (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_020761	D	905	G	PTPRT_HUMAN	Unclassified	---	A/B	D	927	G
2	UniProt	VAR_020762	Q	965	K	PTPRT_HUMAN	Unclassified	---	A/B	Q	987	K
3	UniProt	VAR_020763	A	1096	P	PTPRT_HUMAN	Unclassified	---	A/B	A	1118	P
4	UniProt	VAR_020764	N	1106	I	PTPRT_HUMAN	Unclassified	---	A/B	N	1128	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_020761	D	905	G	PTPRT_HUMAN	Unclassified	---	A	D	927	G
2	UniProt	VAR_020762	Q	965	K	PTPRT_HUMAN	Unclassified	---	A	Q	987	K
3	UniProt	VAR_020763	A	1096	P	PTPRT_HUMAN	Unclassified	---	A	A	1118	P
4	UniProt	VAR_020764	N	1106	I	PTPRT_HUMAN	Unclassified	---	A	N	1128	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_020761	D	905	G	PTPRT_HUMAN	Unclassified	---	B	D	927	G
2	UniProt	VAR_020762	Q	965	K	PTPRT_HUMAN	Unclassified	---	B	Q	987	K
3	UniProt	VAR_020763	A	1096	P	PTPRT_HUMAN	Unclassified	---	B	A	1118	P
4	UniProt	VAR_020764	N	1106	I	PTPRT_HUMAN	Unclassified	---	B	N	1128	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPRT_HUMAN	889-1143 1175-1437	2	A:911-1165 B:911-1165 -
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPRT_HUMAN	1063-1134 1351-1428	2	A:1085-1156 B:1085-1156 -
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPRT_HUMAN	1082-1092 1376-1386	2	A:1104-1114 B:1104-1114 -

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPRT_HUMAN	889-1143 1175-1437	1	A:911-1165 - -
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPRT_HUMAN	1063-1134 1351-1428	1	A:1085-1156 - -
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPRT_HUMAN	1082-1092 1376-1386	1	A:1104-1114 - -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPRT_HUMAN	889-1143 1175-1437	1	- B:911-1165 -
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPRT_HUMAN	1063-1134 1351-1428	1	- B:1085-1156 -
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPRT_HUMAN	1082-1092 1376-1386	1	- B:1104-1114 -

Asymmetric Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1e	ENST00000373187	1e	ENSE00001299020	chr20:41818373-41818286	88	PTPRT_HUMAN	1-30	30	0	-	-
1.3b	ENST00000373187	3b	ENSE00001127453	chr20:41514572-41514447	126	PTPRT_HUMAN	30-72	43	0	-	-
1.4	ENST00000373187	4	ENSE00000662140	chr20:41420106-41419835	272	PTPRT_HUMAN	72-162	91	0	-	-
1.5	ENST00000373187	5	ENSE00001127981	chr20:41408939-41408858	82	PTPRT_HUMAN	163-190	28	0	-	-
1.6	ENST00000373187	6	ENSE00001320663	chr20:41400190-41400075	116	PTPRT_HUMAN	190-228	39	0	-	-
1.7	ENST00000373187	7	ENSE00001295075	chr20:41385276-41385102	175	PTPRT_HUMAN	229-287	59	0	-	-
1.8	ENST00000373187	8	ENSE00001315163	chr20:41306799-41306506	294	PTPRT_HUMAN	287-385	99	0	-	-
1.9	ENST00000373187	9	ENSE00001305193	chr20:41101202-41100906	297	PTPRT_HUMAN	385-484	100	0	-	-
1.10	ENST00000373187	10	ENSE00001329888	chr20:41076969-41076860	110	PTPRT_HUMAN	484-520	37	0	-	-
1.11	ENST00000373187	11	ENSE00001303836	chr20:40980925-40980724	202	PTPRT_HUMAN	521-588	68	0	-	-
1.12	ENST00000373187	12	ENSE00001322891	chr20:40979370-40979268	103	PTPRT_HUMAN	588-622	35	0	-	-
1.13	ENST00000373187	13	ENSE00001303056	chr20:40944636-40944363	274	PTPRT_HUMAN	622-713	92	0	-	-
1.14	ENST00000373187	14	ENSE00001316436	chr20:40911165-40911129	37	PTPRT_HUMAN	714-726	13	0	-	-
1.16	ENST00000373187	16	ENSE00001291858	chr20:40877462-40877327	136	PTPRT_HUMAN	726-771	46	0	-	-
1.17	ENST00000373187	17	ENSE00001296212	chr20:40864898-40864869	30	PTPRT_HUMAN	771-781	11	0	-	-
1.19b	ENST00000373187	19b	ENSE00001324256	chr20:40828028-40827880	149	PTPRT_HUMAN	781-831	51	0	-	-
1.20a	ENST00000373187	20a	ENSE00001304010	chr20:40790182-40789992	191	PTPRT_HUMAN	831-894	64	2	A:889-916 B:888-916	28 29
1.21	ENST00000373187	21	ENSE00001320070	chr20:40770642-40770555	88	PTPRT_HUMAN	895-924	30	2	A:917-946 B:917-946	30 30
1.22	ENST00000373187	22	ENSE00001293417	chr20:40757470-40757394	77	PTPRT_HUMAN	924-949	26	2	A:946-971 (gaps) B:946-971	26 26
1.23	ENST00000373187	23	ENSE00001310313	chr20:40748611-40748575	37	PTPRT_HUMAN	950-962	13	2	A:972-984 B:972-984	13 13
1.24	ENST00000373187	24	ENSE00001289737	chr20:40747140-40747043	98	PTPRT_HUMAN	962-994	33	2	A:984-1016 B:984-1016	33 33
1.26	ENST00000373187	26	ENSE00001304469	chr20:40743955-40743839	117	PTPRT_HUMAN	995-1033	39	2	A:1017-1055 B:1017-1055	39 39
1.27	ENST00000373187	27	ENSE00001290774	chr20:40739127-40738973	155	PTPRT_HUMAN	1034-1085	52	2	A:1056-1107 B:1056-1107	52 52
1.28	ENST00000373187	28	ENSE00001315899	chr20:40735561-40735426	136	PTPRT_HUMAN	1085-1130	46	2	A:1107-1152 B:1107-1152	46 46
1.29	ENST00000373187	29	ENSE00001298748	chr20:40733358-40733209	150	PTPRT_HUMAN	1131-1180	50	2	A:1153-1168 B:1153-1168	16 16
1.30	ENST00000373187	30	ENSE00001314457	chr20:40730937-40730764	174	PTPRT_HUMAN	1181-1238	58	0	-	-
1.31	ENST00000373187	31	ENSE00001304649	chr20:40727192-40727061	132	PTPRT_HUMAN	1239-1282	44	0	-	-
1.32	ENST00000373187	32	ENSE00001326438	chr20:40714493-40714368	126	PTPRT_HUMAN	1283-1324	42	0	-	-
1.33	ENST00000373187	33	ENSE00001299388	chr20:40713485-40713322	164	PTPRT_HUMAN	1325-1379	55	0	-	-
1.34	ENST00000373187	34	ENSE00001317939	chr20:40710657-40710522	136	PTPRT_HUMAN	1379-1424	46	0	-	-
1.35b	ENST00000373187	35b	ENSE00001302529	chr20:40709572-40701392	8181	PTPRT_HUMAN	1425-1441	17	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:278
 aligned with PTPRT_HUMAN | O14522 from UniProtKB/Swiss-Prot  Length:1441

    Alignment length:280
                                   876       886       896       906       916       926       936       946       956       966       976       986       996      1006      1016      1026      1036      1046      1056      1066      1076      1086      1096      1106      1116      1126      1136      1146
         PTPRT_HUMAN    867 PAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLC 1146
               SCOP domains d2ooqa_ A: automated matches                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 2ooqA00 A:889-1168 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                              CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee..hhhhhhhhhhh....hhhhhhhhh............hhhhhhhh.......hhhhh......--hhhhhh..eeee........eeee......hhhhhhhhhhhhh..eeee....ee..ee.........eeee..eeeeeeeeee...eeeeeeeeee......eeeeeeee...........hhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhhhhhhhhheehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------G-----------------------------------------------------------K----------------------------------------------------------------------------------------------------------------------------------P---------I---------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------TYR_PHOSPHATASE_PTP  PDB: A:911-1165 UniProt: 889-1143                                                                                                                                                                                                         --- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:1085-1156 UniProt: 1063-1134                  ------------ PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA------------------------------------------------------ PROSITE (3)
           Transcript 1 (1) Exon 1.20a  PDB: A:889-916  Exon 1.21  PDB: A:917-946     -------------------------Exon 1.23    --------------------------------Exon 1.26  PDB: A:1017-1055            Exon 1.27  PDB: A:1056-1107 UniProt: 1034-1085      ---------------------------------------------Exon 1.29        Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.22 UniProt: 924-949------------Exon 1.24  PDB: A:984-1016       ------------------------------------------------------------------------------------------Exon 1.28  PDB: A:1107-1152 UniProt: 1085-1130---------------- Transcript 1 (2)
                2ooq A  889 MAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVL--DPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLC 1168
                                   898       908       918       928       938       948       | -|      968       978       988       998      1008      1018      1028      1038      1048      1058      1068      1078      1088      1098      1108      1118      1128      1138      1148      1158      1168
                                                                                             956  |                                                                                                                                                                                                                 
                                                                                                959

Chain B from PDB  Type:PROTEIN  Length:281
 aligned with PTPRT_HUMAN | O14522 from UniProtKB/Swiss-Prot  Length:1441

    Alignment length:281
                                   875       885       895       905       915       925       935       945       955       965       975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      1115      1125      1135      1145 
         PTPRT_HUMAN    866 QPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLC 1146
               SCOP domains d2ooqb_ B: automated matches                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2ooqB00 B:888-1168 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                               CATH domains
           Pfam domains (1) ----------------------------------------------Y_phosphatase-2ooqB01 B:934-1164                                                                                                                                                                                                       ---- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------Y_phosphatase-2ooqB02 B:934-1164                                                                                                                                                                                                       ---- Pfam domains (2)
         Sec.struct. author ...ee..hhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhh.......hhhhh................eeee........eeee...hhhhhhhhhhhhhhhh..eeee....ee..ee.........eeee..eeeeeeeeee...eeeeeeeeee.....eeeeeeeee...........hhhhhhhhhhhhhhh......eeee....hhhhhhhhhhhhhhhhhhhhheehhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------G-----------------------------------------------------------K----------------------------------------------------------------------------------------------------------------------------------P---------I---------------------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------TYR_PHOSPHATASE_PTP  PDB: B:911-1165 UniProt: 889-1143                                                                                                                                                                                                         --- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:1085-1156 UniProt: 1063-1134                  ------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA------------------------------------------------------ PROSITE (3)
           Transcript 1 (1) Exon 1.20a  PDB: B:888-916   Exon 1.21  PDB: B:917-946     -------------------------Exon 1.23    --------------------------------Exon 1.26  PDB: B:1017-1055            Exon 1.27  PDB: B:1056-1107 UniProt: 1034-1085      ---------------------------------------------Exon 1.29        Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------Exon 1.22  PDB: B:946-971 ------------Exon 1.24  PDB: B:984-1016       ------------------------------------------------------------------------------------------Exon 1.28  PDB: B:1107-1152 UniProt: 1085-1130---------------- Transcript 1 (2)
                2ooq B  888 SMAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLC 1168
                                   897       907       917       927       937       947       957       967       977       987       997      1007      1017      1027      1037      1047      1057      1067      1077      1087      1097      1107      1117      1127      1137      1147      1157      1167

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: (Phosphotyrosine protein) phosphatases II (296)

Superfamily: (Phosphotyrosine protein) phosphatases II (296)

Family: Higher-molecular-weight phosphotyrosine protein phosphatases (166)

Protein domain: automated matches (23)

Human (Homo sapiens) [TaxId: 9606] (21)

1a	d2ooqa_	A:
1b	d2ooqb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Protein-Tyrosine Phosphatase; Chain A (262)

Homologous Superfamily: Protein tyrosine phosphatase superfamily (228)

Human (Homo sapiens) (196)

1a	2ooqA00	A:889-1168
1b	2ooqB00	B:888-1168

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Phosphatase (121)

Family: Y_phosphatase (93)

Homo sapiens (Human) (82)

1a	Y_phosphatase-2ooqB01	B:934-1164
1b	Y_phosphatase-2ooqB02	B:934-1164

Asymmetric Unit(hide GO term definitions)

Chain A,B (PTPRT_HUMAN | O14522)

molecular function
	GO:0045294	alpha-catenin binding	Interacting selectively and non-covalently with the alpha subunit of the catenin complex.
	GO:0008013	beta-catenin binding	Interacting selectively and non-covalently with the beta subunit of the catenin complex.
	GO:0045296	cadherin binding	Interacting selectively and non-covalently with cadherin, a type I membrane protein involved in cell adhesion.
	GO:0070097	delta-catenin binding	Interacting selectively and non-covalently with the delta subunit of the catenin complex.
	GO:0045295	gamma-catenin binding	Interacting selectively and non-covalently with the gamma subunit of the catenin complex.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	The attachment of a plasma membrane adhesion molecule in one cell to an identical molecule in an adjacent cell.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		B3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ooq)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2ooq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PTPRT_HUMAN \| O14522
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PTPRT_HUMAN \| O14522
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2OOQ)

1lar	CRYSTAL STRUCTURE OF THE TANDEM PHOSPHATASE DOMAINS OF RPTP LAR
1rpm	HUMAN RECEPTOR PROTEIN TYROSINE PHOSPHATASE MU, DOMAIN 1
2c7s	CRYSTAL STRUCTURE OF HUMAN PROTEIN TYROSINE PHOSPHATASE KAPPA
2fh7	CRYSTAL STRUCTURE OF THE PHOSPHATASE DOMAINS OF HUMAN PTP SIGMA

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

PROSITE Motifs (3, 6)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File