Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF ALA14-PYY IN AQUEOUS SOLUTION
 
Authors :  O. Zerbe, A. Neumoin, J. Mares
Date :  26 Jan 07  (Deposition) - 25 Dec 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Peptide Yy, Pyy, Neurohormone, Folding Of Helical Hairpins, Nmr (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Neumoin, J. Mares, M. Lerch-Bader, R. Bader, O. Zerbe
Probing The Formation Of Stable Tertiary Structure In A Model Miniprotein At Atomic Resolution: Determinants Of Stability Of A Helical Hairpin.
J. Am. Chem. Soc. V. 129 8811 2007
PubMed-ID: 17580866  |  Reference-DOI: 10.1021/JA0716960
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PEPTIDE YY
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainDH5A
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GenePYY
    MutationYES
    Organism CommonPIG
    Organism ScientificSUS SCROFA
    Organism Taxid9823
    SynonymPYY, PEPTIDE TYROSINE TYROSINE

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1NH21Mod. Amino AcidAMINO GROUP

(-) Sites  (0, 0)

(no "Site" information available for 2OON)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2OON)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2OON)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OON)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PANCREATIC_HORMONE_2PS50276 Pancreatic hormone family profile.PYY_PIG1-36  1A:1-36
2PANCREATIC_HORMONE_1PS00265 Pancreatic hormone family signature.PYY_PIG20-36  1A:20-36

(-) Exons   (0, 0)

(no "Exon" information available for 2OON)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:37
 aligned with PYY_PIG | P68005 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:37
                                                              36     
                                    10        20        30     | 
               PYY_PIG    1 YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-  -
               SCOP domains d2oona1 A:1-36 Peptide YY, PYY      - SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains Hormone_3-2oonA01 A:1-36            - Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                PROSITE (1) PANCREATIC_HORMONE_2  PDB: A:1-36   - PROSITE (1)
                PROSITE (2) -------------------PANCREATIC_HORMON- PROSITE (2)
                 Transcript ------------------------------------- Transcript
                  2oon A  1 YPAKPEAPGEDASAEELSRYYASLRHYLNLVTRQRYx 37
                                    10        20        30      |
                                                               37-NH2

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Peptides (792)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2OON)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (10, 10)

NMR Structure(hide GO term definitions)
Chain A   (PYY_PIG | P68005)
molecular function
    GO:0005179    hormone activity    The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
    GO:0031841    neuropeptide Y receptor binding    Interacting selectively and non-covalently with a neuropeptide Y receptor.
    GO:0005184    neuropeptide hormone activity    The action characteristic of a neuropeptide hormone, any peptide hormone that acts in the central nervous system. A neuropeptide is any of several types of molecules found in brain tissue, composed of short chains of amino acids; they include endorphins, enkephalins, vasopressin, and others. They are often localized in axon terminals at synapses and are classified as putative neurotransmitters, although some are also hormones.
biological process
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0007631    feeding behavior    Behavior associated with the intake of food.
    GO:0007218    neuropeptide signaling pathway    The series of molecular signals generated as a consequence of a peptide neurotransmitter binding to a cell surface receptor.
    GO:0032098    regulation of appetite    Any process which modulates appetite, the desire or physical craving for food.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NH2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2oon)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oon)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2oon
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PYY_PIG | P68005
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PYY_PIG | P68005
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PYY_PIG | P680051qbf 1ru5 1ruu 2oop 2rlk

(-) Related Entries Specified in the PDB File

1ru5 PYY IN AQUEOUS SOLUTION
1ruu PYY IN MICELLAR (DPC) SOLUTION
2ooo REFINED STRUCTURE OF PYY IN WATER
2oop STRUCTURE OF TYR7-PYY IN SOLUTION