|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric/Biological Unit (3, 5) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2ONR) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2ONR) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2ONR) |
Exons (0, 0)| (no "Exon" information available for 2ONR) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:314 aligned with WTPA_ARCFU | O30142 from UniProtKB/Swiss-Prot Length:342 Alignment length:338 14 24 34 44 54 64 74 84 94 104 114 124 134 144 154 164 174 184 194 204 214 224 234 244 254 264 274 284 294 304 314 324 334 WTPA_ARCFU 5 GGVVKIRILILLMLALFLLGCSSNVNTNVKLKVFHAGSLTEPMKAFKRAFEEKHPNVEVQTEAAGSAATIRKVTELGRKADVIATADYTLIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADEINSQNWYEILKRPDVRFGFSNPNDDPCGYRSLMAIQLAELYYNDPTIFDELVAKNSNLRFSEDNGSYVLRMPSSERIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVEIDLSSPDYAELYSKVKVVLANGKEVTGKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS 342 SCOP domains d 2onra_ A: Molybdate-binding protein, ModA SCOP domains CATH domains 2 onrA01 A:29-112,A:284-342 Periplasmic binding protein-like II 2onrA02 A:113-283 Periplasmic binding protein-like II 2onrA01 A:29-112,A:284-342 CATH domains Pfam domains -----------------------------------SBP_bac_1-2onrA01 A:40-313 ----------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (WTPA_ARCFU | O30142)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|