2OBY - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN P53 INDUCIBLE OXIDOREDUCTASE (TP53I3,PIG3)

Authors :   S. Porte, E. Valencia, J. Farres, I. Fita, A. C. W. Pike, N. Shafqat, J. De C. Johansson, A. Haroniti, O. Gileadi, C. H. Arrowsmith, A. Edwards, J M. Sundstrom, F. Von Delft, U. Oppermann, X. Pares

Date :   20 Dec 06 (Deposition) - 30 Jan 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B,C,D,E
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C  (2x)
Biol. Unit 3: D  (2x)
Biol. Unit 4: E  (2x)

Keywords :   Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Porte, E. Valencia, J. Farres, I. Fita, A. C. W. Pike, N. Shafqat, J. Debreczeni, C. Johansson, A. Haroniti, O. Gileadi, C. H. Arrowsmith, A. Edwards, J. Weigelt, M. Sundstrom, F. Von Delft, U. Oppermann, X. Pares
Crystal Structure Of Human P53 Inducible Oxidoreductase (Tp53I3, Pig3)
To Be Published
PubMed: search

Molecule 1 - PUTATIVE QUINONE OXIDOREDUCTASE
	Chains	:	A, B, C, D, E
	EC Number	:	1.-.-.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Plasmid	:	PGEX-4T-2
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Gene	:	TP53I3, PIG3
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TUMOR PROTEIN P53- INDUCIBLE PROTEIN 3, P53-INDUCED PROTEIN 3

		1	2	3	4	5
Asymmetric Unit	:	A	B	C	D	E
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (2x)	:			C
Biological Unit 3 (2x)	:				D
Biological Unit 4 (2x)	:					E

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 5)

No.	Name	Count	Type	Full Name
1	NAP	5	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 3 (1, 2)

No.	Name	Count	Type	Full Name
1	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 4 (1, 2)

No.	Name	Count	Type	Full Name
1	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN A:40 , ARG A:41 , GLU A:123 , THR A:127 , ALA A:148 , SER A:151 , GLY A:152 , VAL A:153 , ALA A:172 , GLY A:173 , LYS A:177 , TYR A:192 , ILE A:217 , TYR A:221 , TYR A:238 , GLY A:239 , MET A:241 , GLY A:242 , SER A:264 , LEU A:265 , LEU A:266 , MET A:317 , ASN A:320 , ASN A:322	BINDING SITE FOR RESIDUE NAP A 1400
2	AC2	SOFTWARE	ASN B:40 , ARG B:41 , GLU B:123 , THR B:127 , ALA B:148 , SER B:151 , GLY B:152 , VAL B:153 , ALA B:172 , GLY B:173 , LYS B:177 , TYR B:192 , ILE B:217 , TYR B:238 , MET B:241 , SER B:264 , LEU B:265 , LEU B:266 , MET B:317 , ASN B:322	BINDING SITE FOR RESIDUE NAP B 1401
3	AC3	SOFTWARE	ARG C:41 , GLU C:123 , THR C:127 , ALA C:148 , SER C:151 , GLY C:152 , VAL C:153 , ALA C:172 , GLY C:173 , LYS C:177 , TYR C:192 , ILE C:217 , TYR C:221 , TYR C:238 , MET C:241 , SER C:264 , LEU C:266 , MET C:317 , ASN C:322	BINDING SITE FOR RESIDUE NAP C 1402
4	AC4	SOFTWARE	ASN D:40 , ARG D:41 , GLU D:123 , THR D:127 , ALA D:148 , SER D:151 , GLY D:152 , VAL D:153 , ALA D:172 , GLY D:173 , LYS D:177 , TYR D:192 , TYR D:221 , TYR D:238 , MET D:241 , SER D:264 , LEU D:265 , LEU D:266 , MET D:317 , ASN D:320 , ASN D:322	BINDING SITE FOR RESIDUE NAP D 1403
5	AC5	SOFTWARE	ASN E:40 , ARG E:41 , GLU E:123 , THR E:127 , ALA E:148 , SER E:151 , GLY E:152 , VAL E:153 , ALA E:172 , GLY E:173 , LYS E:177 , TYR E:192 , ILE E:217 , TYR E:221 , TYR E:238 , MET E:241 , SER E:264 , LEU E:265 , LEU E:266 , MET E:317 , ASN E:320 , ASN E:322	BINDING SITE FOR RESIDUE NAP E 1404

(no "SS Bond" information available for 2OBY)

(no "Cis Peptide Bond" information available for 2OBY)

Asymmetric Unit (2, 10)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033032	M	180	K	QORX_HUMAN	Unclassified	---	A/B/C/D/E	M	180	K
2	UniProt	VAR_048201	E	223	K	QORX_HUMAN	Polymorphism	35176319	A/B/C/D/E	E	223	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033032	M	180	K	QORX_HUMAN	Unclassified	---	A/B	M	180	K
2	UniProt	VAR_048201	E	223	K	QORX_HUMAN	Polymorphism	35176319	A/B	E	223	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033032	M	180	K	QORX_HUMAN	Unclassified	---	C	M	180	K
2	UniProt	VAR_048201	E	223	K	QORX_HUMAN	Polymorphism	35176319	C	E	223	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033032	M	180	K	QORX_HUMAN	Unclassified	---	D	M	180	K
2	UniProt	VAR_048201	E	223	K	QORX_HUMAN	Polymorphism	35176319	D	E	223	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033032	M	180	K	QORX_HUMAN	Unclassified	---	E	M	180	K
2	UniProt	VAR_048201	E	223	K	QORX_HUMAN	Polymorphism	35176319	E	E	223	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2OBY)

Asymmetric Unit (5, 25)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000335934	2a	ENSE00001850009	chr2:24308085-24307601	485	QORX_HUMAN	-	0	0	-	-
1.2f	ENST00000335934	2f	ENSE00001347001	chr2:24307201-24307059	143	QORX_HUMAN	1-46	46	5	A:1-46 B:1-46 C:1-46 D:1-46 E:1-46	46 46 46 46 46
1.3b	ENST00000335934	3b	ENSE00000721478	chr2:24306022-24305755	268	QORX_HUMAN	47-136	90	5	A:47-136 B:47-136 C:47-136 D:47-136 E:47-136	90 90 90 90 90
1.4a	ENST00000335934	4a	ENSE00001690893	chr2:24303901-24303689	213	QORX_HUMAN	136-207	72	5	A:136-207 B:136-207 C:136-207 D:136-207 E:136-207	72 72 72 72 72
1.5b	ENST00000335934	5b	ENSE00000721466	chr2:24302510-24302314	197	QORX_HUMAN	207-272	66	5	A:207-272 B:207-272 C:207-272 D:207-272 E:207-272	66 66 66 66 66
1.6d	ENST00000335934	6d	ENSE00001743570	chr2:24300631-24300303	329	QORX_HUMAN	273-332	60	5	A:273-332 B:273-332 C:273-332 D:273-332 E:273-332	60 60 60 60 60

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:334
 aligned with QORX_HUMAN | Q53FA7 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:334
                              1                                                                                                                                                                                                                                                                                                                                           
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328    
           QORX_HUMAN     - --MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee....hhh.eeeeeee.......eeeeeeeeee.hhhhhhhhhh..............eeeeeeeee............eeeee........eeeee...eee.....hhhhhh.hhhhhhhhhhhhh.........eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhh...eeee....hhhhhhhhhh....eeeeee..hhhhhhhhhhheeeeeeeee........eeehhhhhhhhh..eeee......hhhhhhhhhhhhhhhhhhhhhh.........eeeeee..hhhhhhhhhhh.....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------K------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) --Exon 1.2f  PDB: A:1-46 UniProt: 1-46          Exon 1.3b  PDB: A:47-136 UniProt: 47-136                                                  ----------------------------------------------------------------------Exon 1.5b  PDB: A:207-272 UniProt: 207-272                        Exon 1.6d  PDB: A:273-332 UniProt: 273-332                   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: A:136-207 UniProt: 136-207                              ----------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2oby A  -1 IPMLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328

Chain B from PDB  Type:PROTEIN  Length:334
 aligned with QORX_HUMAN | Q53FA7 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:334
                              1                                                                                                                                                                                                                                                                                                                                           
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328    
           QORX_HUMAN     - --MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.....hhhhheeeeee.......eeeeeeeeeeehhhhhhhhhh..............eeeeeeeee............eeeee........eeeee...ee......hhhhhh.hhhhhhhhhhhhhh........eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhh...eeee....hhhhhhhhhh....eeeeee.....hhhhhhhheeeeeeeee........eeehhhhhhhhh..eee.......hhhhhhhhhhhhhhhhhhhhhh.........eeeeee..hhhhhhhhhhh.....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------K------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) --Exon 1.2f  PDB: B:1-46 UniProt: 1-46          Exon 1.3b  PDB: B:47-136 UniProt: 47-136                                                  ----------------------------------------------------------------------Exon 1.5b  PDB: B:207-272 UniProt: 207-272                        Exon 1.6d  PDB: B:273-332 UniProt: 273-332                   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: B:136-207 UniProt: 136-207                              ----------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2oby B  -1 IPMLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328

Chain C from PDB  Type:PROTEIN  Length:334
 aligned with QORX_HUMAN | Q53FA7 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:334
                              1                                                                                                                                                                                                                                                                                                                                           
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328    
           QORX_HUMAN     - --MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.....hhhhheeeeee.......eeeeeeeeeeehhhhhhhhhh..............eeeeeeeee............eeeee........eeeee...ee......hhhhhh.hhhhhhhhhhhhh.........eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhh..eeee....hhhhhhhhhh....eeeeee..hhhhhhhhhhheeeeeeeee...........hhhhhhhhhh.eeee......hhhhhhhhhhhhhhhhhhhhhh.........eeeeee..hhhhhhhhhhh.....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------K------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) --Exon 1.2f  PDB: C:1-46 UniProt: 1-46          Exon 1.3b  PDB: C:47-136 UniProt: 47-136                                                  ----------------------------------------------------------------------Exon 1.5b  PDB: C:207-272 UniProt: 207-272                        Exon 1.6d  PDB: C:273-332 UniProt: 273-332                   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: C:136-207 UniProt: 136-207                              ----------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2oby C  -1 IPMLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328

Chain D from PDB  Type:PROTEIN  Length:334
 aligned with QORX_HUMAN | Q53FA7 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:334
                              1                                                                                                                                                                                                                                                                                                                                           
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328    
           QORX_HUMAN     - --MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.....hhhhheeeeee.......eeeeeeeeee.hhhhhhhhhh..............eeeeeeeee............eeeee........eeeee...ee......hhhhhh.hhhhhhhhhhhhh.........eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhh...eeee....hhhhhhhhhh....eeeeee..hhhhhhhhhhheeeeeeeee...........hhhhhhhhhh.eeee......hhhhhhhhhhhhhhhhhhhhh..........eeeeee..hhhhhhhhhhh.....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------K------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) --Exon 1.2f  PDB: D:1-46 UniProt: 1-46          Exon 1.3b  PDB: D:47-136 UniProt: 47-136                                                  ----------------------------------------------------------------------Exon 1.5b  PDB: D:207-272 UniProt: 207-272                        Exon 1.6d  PDB: D:273-332 UniProt: 273-332                   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: D:136-207 UniProt: 136-207                              ----------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2oby D  -1 IPMLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328

Chain E from PDB  Type:PROTEIN  Length:334
 aligned with QORX_HUMAN | Q53FA7 from UniProtKB/Swiss-Prot  Length:332

    Alignment length:334
                              1                                                                                                                                                                                                                                                                                                                                           
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328    
           QORX_HUMAN     - --MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------------------ADH_N-2obyE01 E:27-97                                                  ------------------------------------------------------ADH_zinc_N-2obyE06 E:152-282                                                                                                       -------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------------------------ADH_N-2obyE02 E:27-97                                                  ------------------------------------------------------ADH_zinc_N-2obyE07 E:152-282                                                                                                       -------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----------------------------ADH_N-2obyE03 E:27-97                                                  ------------------------------------------------------ADH_zinc_N-2obyE08 E:152-282                                                                                                       -------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----------------------------ADH_N-2obyE04 E:27-97                                                  ------------------------------------------------------ADH_zinc_N-2obyE09 E:152-282                                                                                                       -------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ----------------------------ADH_N-2obyE05 E:27-97                                                  ------------------------------------------------------ADH_zinc_N-2obyE10 E:152-282                                                                                                       -------------------------------------------------- Pfam domains (5)
         Sec.struct. author .eeeeeee....hhh.eeeeeee.......eeeeeeeeee.hhhhhhhhhh..............eeeeeeeee............eeeee........eeeee.hhhee.....hhhhhh.hhhhhhhhhhhhh.........eeeee...hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhh..eeee....hhhhhhhhhh....eeeeee.....hhhhhhhheeeeeeeee...........hhhhhhhhh..eeee......hhhhhhhhhhhhhhhhhhhhh..........eeeeee..hhhhhhhhhhh.....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------K------------------------------------------K------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) --Exon 1.2f  PDB: E:1-46 UniProt: 1-46          Exon 1.3b  PDB: E:47-136 UniProt: 47-136                                                  ----------------------------------------------------------------------Exon 1.5b  PDB: E:207-272 UniProt: 207-272                        Exon 1.6d  PDB: E:273-332 UniProt: 273-332                   Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------Exon 1.4a  PDB: E:136-207 UniProt: 136-207                              ----------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2oby E  -1 IPMLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ 332
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2OBY)

(no "CATH Domain" information available for 2OBY)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: GroES (70)

Family: ADH_N (62)

Homo sapiens (Human) (18)

1a	ADH_N-2obyE01	E:27-97
1b	ADH_N-2obyE02	E:27-97
1c	ADH_N-2obyE03	E:27-97
1d	ADH_N-2obyE04	E:27-97
1e	ADH_N-2obyE05	E:27-97

Clan: NADP_Rossmann (1239)

Family: ADH_zinc_N (75)

Homo sapiens (Human) (24)

2a	ADH_zinc_N-2obyE06	E:152-282
2b	ADH_zinc_N-2obyE07	E:152-282
2c	ADH_zinc_N-2obyE08	E:152-282
2d	ADH_zinc_N-2obyE09	E:152-282
2e	ADH_zinc_N-2obyE10	E:152-282

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E (QORX_HUMAN | Q53FA7)

molecular function
	GO:0070402	NADPH binding	Interacting selectively and non-covalently with the reduced form, NADPH, of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions.
	GO:0003960	NADPH:quinone reductase activity	Catalysis of the reaction: NADPH + H+ + quinone = NADP+ + semiquinone.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0048038	quinone binding	Interacting selectively and non-covalently with a quinone, any member of a class of diketones derivable from aromatic compounds by conversion of two CH groups into CO groups with any necessary rearrangement of double bonds.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006739	NADP metabolic process	The chemical reactions and pathways involving nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; metabolism may be of either the oxidized form, NADP, or the reduced form, NADPH.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2oby)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2oby
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	QORX_HUMAN \| Q53FA7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.-.-.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	QORX_HUMAN \| Q53FA7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	QORX_HUMAN \| Q53FA7	:	2j8z

(no "Related Entries Specified in the PDB File" available for 2OBY)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 10)

PROSITE Motifs (0, 0)

Exons (5, 25)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (2, 10)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File