|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 10)| Asymmetric/Biological Unit (4, 10) |
Sites (8, 8)
Asymmetric Unit (8, 8)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2NUO) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2NUO) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2NUO) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:122 aligned with GRFIN_GRISQ | P84801 from UniProtKB/Swiss-Prot Length:121 Alignment length:122 1 | 9 19 29 39 49 59 69 79 89 99 109 119 GRFIN_GRISQ - -SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDXIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY 121 SCOP domains -d2nuoa1 A:1-121 Griffithsin SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -JACALIN_LECTIN PDB: A:1-120 UniProt: 1-120 - PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 2nuo A 0 xSLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY 121 | 9 19 29 39 49 59 69 79 89 99 109 119 | 0-ACE Chain B from PDB Type:PROTEIN Length:122 aligned with GRFIN_GRISQ | P84801 from UniProtKB/Swiss-Prot Length:121 Alignment length:122 1 | 9 19 29 39 49 59 69 79 89 99 109 119 GRFIN_GRISQ - -SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDXIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY 121 SCOP domains -d2nuob1 B:1-121 Griffithsin SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) -------------Jacalin-2nuoB01 B:13-120 - Pfam domains (1) Pfam domains (2) -------------Jacalin-2nuoB02 B:13-120 - Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -JACALIN_LECTIN PDB: B:1-120 UniProt: 1-120 - PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 2nuo B 0 xSLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY 121 | 9 19 29 39 49 59 69 79 89 99 109 119 0-ACE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2NUO) |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (GRFIN_GRISQ | P84801)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|