|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2NT3) |
Sites (0, 0)| (no "Site" information available for 2NT3) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2NT3) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2NT3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2NT3) |
Exons (0, 0)| (no "Exon" information available for 2NT3) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:122 aligned with O68522_MYXXA | O68522 from UniProtKB/TrEMBL Length:562 Alignment length:122 11 21 31 41 51 61 71 81 91 101 111 121 O68522_MYXXA 2 SKKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEYVAKPVDADQLVERAGALIGFP 123 SCOP domains d2nt3a_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---Response_reg-2nt3A01 A:5-116 ------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 2nt3 A 2 SKKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIVIIGNPDGFAQHRKLKAHADEAVAKPVDADQLVERAGALIGFP 123 11 21 31 41 51 61 71 81 91 101 111 121
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2NT3) |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (O68522_MYXXA | O68522)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|