Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NEURONAL BUNGAROTOXIN, NMR, 10 STRUCTURES
 
Authors :  R. E. Oswald, M. J. Sutcliffe, M. Bamberger, R. H. Loring, E. Braswell, C. M. Dobson
Date :  29 Oct 97  (Deposition) - 11 Mar 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (10x)
Keywords :  Toxin, Venom, Neurotoxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. J. Sutcliffe, C. M. Dobson, R. E. Oswald
Solution Structure Of Neuronal Bungarotoxin Determined By Two-Dimensional Nmr Spectroscopy: Calculation Of Tertiary Structure Using Systematic Homologous Model Building, Dynamical Simulated Annealing, And Restrained Molecular Dynamics.
Biochemistry V. 31 2962 1992
PubMed-ID: 1550821  |  Reference-DOI: 10.1021/BI00126A017
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NEURONAL BUNGAROTOXIN
    Chains: A, B
    Organism Common: MANY-BANDED KRAIT
    Organism Scientific: BUNGARUS MULTICINCTUS
    Organism Taxid: 8616
    Secretion: VENOM

 Structural Features

(-) Chains, Units

  
NMR Structure (10x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2NBT)

(-) Sites  (0, 0)

(no "Site" information available for 2NBT)

(-) SS Bonds  (10, 10)

NMR Structure
No.Residues
1A:3 -A:21
2A:14 -A:42
3A:27 -A:31
4A:46 -A:58
5A:59 -A:64
6B:3 -B:21
7B:14 -B:42
8B:27 -B:31
9B:46 -B:58
10B:59 -B:64

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2NBT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NBT)

(-) PROSITE Motifs  (1, 2)

NMR Structure (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3LKB_BUNMU62-83
 		  2A:41-62
B:41-62

(-) Exons   (0, 0)

(no "Exon" information available for 2NBT)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:66
 aligned with 3LKB_BUNMU | P01398 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:66
                                    31        41        51        61        71        81      
            3LKB_BUNMU   22 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 87
               SCOP domains d2nbta_ A: Bungarotoxin                                            SCOP domains
               CATH domains 2nbtA00 A:1-66 CD59                                                CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................eeeeee..........eeeee.............eeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------SNAKE_TOXIN           ---- PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  2nbt A  1 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 66
                                    10        20        30        40        50        60      


Chain B from PDB  Type:PROTEIN  Length:66
 aligned with 3LKB_BUNMU | P01398 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:66
                                    31        41        51        61        71        81      
            3LKB_BUNMU   22 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 87
               SCOP domains d2nbtb_ B: Bungarotoxin                                            SCOP domains
               CATH domains 2nbtB00 B:1-66 CD59                                                CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....................eeeeee..........eeeee.............eeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------SNAKE_TOXIN           ---- PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  2nbt B  1 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 66
                                    10        20        30        40        50        60
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2NBT)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A,B   (3LKB_BUNMU | P01398)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0035792    other organism postsynaptic membrane    A postsynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A postsynaptic membrane is a specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters transmit the signal across the synaptic cleft to the postsynaptic membrane.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2nbt)
 
  Sites
(no "Sites" information available for 2nbt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2nbt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2nbt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  3LKB_BUNMU | P01398
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  3LKB_BUNMU | P01398
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        3LKB_BUNMU | P01398: 1kba

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2NBT)