|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1KBA) |
(no "Site" information available for 1KBA) |
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1KBA) |
(no "SAP(SNP)/Variant" information available for 1KBA) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1KBA) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:66 aligned with 3LKB_BUNMU | P01398 from UniProtKB/Swiss-Prot Length:87 Alignment length:66 31 41 51 61 71 81 3LKB_BUNMU 22 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 87 SCOP domains d1kbaa_ A: Bungarotoxin SCOP domains CATH domains 1kbaA00 A:1-66 CD59 CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ----------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ------------------------------------------------------------------ Transcript 1kba A 1 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:66 aligned with 3LKB_BUNMU | P01398 from UniProtKB/Swiss-Prot Length:87 Alignment length:66 31 41 51 61 71 81 3LKB_BUNMU 22 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 87 SCOP domains d1kbab_ B: Bungarotoxin SCOP domains CATH domains 1kbaB00 B:1-66 CD59 CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE ----------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ------------------------------------------------------------------ Transcript 1kba B 1 RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH 66 10 20 30 40 50 60
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 1KBA) |
Asymmetric Unit(hide GO term definitions) Chain A,B (3LKB_BUNMU | P01398)
|
|
|
|
|
|
|