Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE LYSM REGION OF THE E. COLI INTIMIN PERIPLASMIC DOMAIN
 
Authors :  M. Coles, M. Chaubey, J. C. Leo, D. Linke, M. C. Schuetz, F. Goetz, I. B. Au
Date :  05 Jun 14  (Deposition) - 12 Nov 14  (Release) - 14 Jan 15  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (23x)
NMR Structure *:  A  (1x)
Keywords :  Peptidoglycan Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. C. Leo, P. Oberhettinger, M. Chaubey, M. Schutz, D. Kuhner, U. Bertsche, H. Schwarz, F. Gotz, I. B. Autenrieth, M. Coles, D. Linke
The Intimin Periplasmic Domain Mediates Dimerisation And Binding To Peptidoglycan.
Mol. Microbiol. V. 95 80 2015
PubMed-ID: 25353290  |  Reference-DOI: 10.1111/MMI.12840

(-) Compounds

Molecule 1 - INTIMIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPASK-IBA
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentLYSM REGION (UNP RESIDUES 39-143)
    GeneEAE, EAEA, E2348C_3939
    MutationYES
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymATTACHING AND EFFACING PROTEIN, EAE PROTEIN

 Structural Features

(-) Chains, Units

  1
NMR Structure (23x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2MPW)

(-) Sites  (0, 0)

(no "Site" information available for 2MPW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2MPW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2MPW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2MPW)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LYSMPS51782 LysM domain profile.EAE_ECO2763-112  1A:63-112
NMR Structure * (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LYSMPS51782 LysM domain profile.EAE_ECO2763-112  1A:63-112

(-) Exons   (0, 0)

(no "Exon" information available for 2MPW)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:115
 aligned with EAE_ECO27 | P19809 from UniProtKB/Swiss-Prot  Length:939

    Alignment length:263
                                    48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298   
            EAE_ECO27    39 ANGENYFKLGSDSKLLTHNSYQNRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKAAPGQQIILPLKKLPFEYSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKALNYAAQQAASLGSQLQSRSLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPENMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFK 301
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh........hhhhhhhhheeeee.....hhhhhhhhhh.hhhhhhhhhh....hhhhhhh.....eeeee..............................----------------------------------------------------h----------------------hh----------------hh-------------------..---------------------------------------... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------LYSM  PDB: A:63-112 UniProt: 63-112               --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2mpw A  39 MNGENYFKLGSDSKLLTHNSYQNRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKAAPGQQIILPLKKLPFEYSALPLLGSAPLVAAGGVAGHTN----------------------------------------------------G----------------------SG----------------SE-------------------NL---------------------------------------YFQ 153
                                    48        58        68        78        88        98       108       118       128       138    |    -         -         -         -         -       | -         -         -||       -       148         -       149|        -         -         -         -|  
                                                                                                                                  143                                                  144                    145|              147|                 149|                                     151  
                                                                                                                                                                                                               146               148                  150                                          

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2MPW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2MPW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2MPW)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain A   (EAE_ECO27 | P19809)
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2mpw)
 
  Sites
(no "Sites" information available for 2mpw)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2mpw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2mpw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EAE_ECO27 | P19809
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  EAE_ECO27 | P19809
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EAE_ECO27 | P198091e5u 1f00 1f02

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2MPW)