Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR REPRESENTATIVE STRUCTURE OF INTIMIN-190 (INT190) FROM ENTEROPATHOGENIC E. COLI
 
Authors :  S. Prasannan, S. J. Matthews, M. Batchelor, S. Daniell, S. Reece, G. Frankel, G. Dougan, I. Connerton, G. Bloomberg
Date :  02 Aug 00  (Deposition) - 16 Aug 00  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  I
Keywords :  Intimin, Escherichia Coli, Cell Adhesion, Outer Membrane Protein, Nmr Spectroscopy (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Batchelor, S. Prasannan, S. Daniell, S. Reece, I. Connerton, G. Bloomberg, G. Dougan, G. Frankel, S. J. Matthews
Structural Basis For Recognition Of The Translocated Intimin Receptor (Tir) By Intimin From Enteropathogenic E. Coli
Embo J. V. 19 2452 2000
PubMed-ID: 10835344  |  Reference-DOI: 10.1093/EMBOJ/19.11.2452

(-) Compounds

Molecule 1 - INTIMIN
    Cell: BACTERIAL
    Cellular Location: OUTER MEMBRANE/SURFACE
    Chains: I
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Gene: EAE [TRUNCATION]
    Expression System Plasmid: PET3A/PLYSS
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Fragment: C-TERMINAL 190 RESIDUE-FRAGMENT
    Gene: EAE
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Other Details: RECOMBINANT
    Strain: ENTEROPATHOGENIC SEROTYPE O127:H6
    Synonym: INT190
    Variant: STRAIN E2348/69

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1E5U)

(-) Sites  (0, 0)

(no "Site" information available for 1E5U)

(-) SS Bonds  (1, 1)

NMR Structure
No.Residues
1I:108 -I:185

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1E5U)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1E5U)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1E5U)

(-) Exons   (0, 0)

(no "Exon" information available for 1E5U)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain I from PDB  Type:PROTEIN  Length:187
 aligned with EAE_ECO27 | P19809 from UniProtKB/Swiss-Prot  Length:939

    Alignment length:187
                                   762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       
            EAE_ECO27   753 TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK 939
               SCOP domains d1e5ui1 I:1-89 Intimin                                                                   d1e5ui2 I:90-187 Intimin                                                                           SCOP domains
               CATH domains 1e5uI01 I:1-90  [code=2.60.40.1080, no name defined]                                      1e5uI02 I:91-187 Mannose-Binding Protein A, subunit A                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeee....eee..........eeeeeee.......ee.......eee...eeee......eeeee.......eeeee......eeee.....hhhhhhhhhhhh......hhhhhhhhhhhhh...hhhhhhhh...eeee..hhhhhhh..eeeee....eeeeee........eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1e5u I   1 TLTIDDGNIEIVGTGVKGKLPTVWLQYGQVNLKASGGNGKYTWRSANPAIASVDASSGQVTLKEKGTTTISVISSDNQTATYTIATPNSLIVPNMSKRVTYNDAVNTCKNFGGKLPSSQNELENVFKAWGAANKYEYYKSSQTIISWVQQTAQDAKSGVASTYDLVKQNPLNNIKASESNAYATCVK 187
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

NMR Structure
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (2, 2)

NMR Structure
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1E5U)

(-) Gene Ontology  (5, 5)

NMR Structure(hide GO term definitions)
Chain I   (EAE_ECO27 | P19809)
biological process
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1e5u)
 
  Sites
(no "Sites" information available for 1e5u)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1e5u)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1e5u
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EAE_ECO27 | P19809
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  EAE_ECO27 | P19809
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EAE_ECO27 | P19809: 1f00 1f02 2mpw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1E5U)