2MM3 - JenaLib

Title :   SOLUTION NMR STRUCTURE OF THE TERNARY COMPLEX OF HUMAN ILEAL BILE ACID-BINDING PROTEIN WITH GLYCOCHOLATE AND GLYCOCHENODEOXYCHOLATE

Authors :   G. Horvath, O. Egyed, A. Bencsura, A. Simon, G. P. Tochtrop, G. T. Dekost D. F. Covey, D. P. Cistola, O. Toke

Date :   07 Mar 14 (Deposition) - 07 May 14 (Release) - 30 Dec 15 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (10x)
NMR Structure *: A  (1x)

Keywords :   Lipid-Binding Protein, Orthogonal Beta Sheets, Positive Binding Cooperativity, Site-Selectivity, Enterohepatic Circulation, Lipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Horvath, A. Bencsura, A. Simon, G. P. Tochtrop, G. T. Dekoster, D. F. Covey, D. P. Cistola, O. Toke
Structural Determinants Of Ligand Binding In The Ternary Complex Of Human Ileal Bile Acid-Binding Protein With Glycocholate And Glycochenodeoxycholate Obtained From Solution Nmr
Febs J. 2015
PubMed-ID: 26613247 | Reference-DOI: 10.1111/FEBS.13610
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

NMR Structure (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE A:2 , PHE A:6 , MET A:8 , MET A:18 , ALA A:31 , ILE A:36 , THR A:38 , VAL A:40 , PHE A:47 , TRP A:49 , GLN A:51 , MET A:74 , LEU A:90 , SER A:101 , GLU A:102 , LEU A:108 , VAL A:109 , GLU A:110 , TYR A:119 , ARG A:121 , SER A:123 , CHO A:202	BINDING SITE FOR RESIDUE GCH A 201
2	AC2	SOFTWARE	LEU A:21 , ILE A:23 , TRP A:49 , ASN A:61 , PHE A:63 , GLN A:72 , THR A:73 , MET A:74 , GLY A:75 , LYS A:77 , PHE A:79 , VAL A:83 , LEU A:90 , VAL A:92 , TYR A:97 , GLN A:99 , GCH A:201	BINDING SITE FOR RESIDUE CHO A 202

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

NMR Structure (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_039578	R	33	H	FABP6_HUMAN	Polymorphism	17856662	A	R	32	H
2	UniProt	VAR_039579	S	55	Y	FABP6_HUMAN	Polymorphism	17852045	A	S	54	Y
3	UniProt	VAR_039580	T	79	M	FABP6_HUMAN	Polymorphism	1130435	A	T	78	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_039578	R	33	H	FABP6_HUMAN	Polymorphism	17856662	A	R	32	H
2	UniProt	VAR_039579	S	55	Y	FABP6_HUMAN	Polymorphism	17852045	A	S	54	Y
3	UniProt	VAR_039580	T	79	M	FABP6_HUMAN	Polymorphism	1130435	A	T	78	M

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:127
 aligned with FABP6_HUMAN | P51161 from UniProtKB/Swiss-Prot  Length:128

    Alignment length:127
                                    11        21        31        41        51        61        71        81        91       101       111       121       
          FABP6_HUMAN     2 AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA 128
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeehhhhhhhhhh..hhhhhhhhhhh.eeeeeee..eeeeeeee...eeeeeeee......ee.....ee....ee....ee.....eeeeeeee..eeeeeeee..eeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------H---------------------Y-----------------------M------------------------------------------------- SAPs(SNPs)
                    PROSITE ---FABP  PDB: A:4-21 ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2mm3 A   1 AFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA 127
                                    10        20        30        40        50        60        70        80        90       100       110       120

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

NMR Structure(hide GO term definitions)

Chain A (FABP6_HUMAN | P51161)

molecular function
	GO:0032052	bile acid binding	Interacting selectively and non-covalently with bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0005215	transporter activity	Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
	GO:0015721	bile acid and bile salt transport	The directed movement of bile acid and bile salts into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0008206	bile acid metabolic process	The chemical reactions and pathways involving bile acids, any of a group of steroid carboxylic acids occurring in bile, where they are present as the sodium salts of their amides with glycine or taurine.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0006869	lipid transport	The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0019433	triglyceride catabolic process	The chemical reactions and pathways resulting in the breakdown of a triglyceride, any triester of glycerol.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CHO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GCH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2mm3)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2mm3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FABP6_HUMAN \| P51161
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FABP6_HUMAN \| P51161
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description