|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MK3) |
Sites (0, 0)| (no "Site" information available for 2MK3) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2MK3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MK3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MK3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MK3) |
Exons (0, 0)| (no "Exon" information available for 2MK3) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:68 aligned with D0VWW0_9HIV1 | D0VWW0 from UniProtKB/TrEMBL Length:226 Alignment length:73 102 112 122 132 142 152 162 D0VWW0_9HIV1 93 SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAGGSGGHTTWMEWDREINNYTSLIHSLIEESQNQQEK 165 SCOP domains d2mk3a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MK3) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MK3) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2MK3)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|