|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 2MHB) |
(no "Cis Peptide Bond" information available for 2MHB) |
Asymmetric Unit (2, 2)
|
Asymmetric Unit (1, 2) Biological Unit 1 (1, 4) |
(no "Exon" information available for 2MHB) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:141 aligned with HBA_HORSE | P01958 from UniProtKB/Swiss-Prot Length:142 Alignment length:141 11 21 31 41 51 61 71 81 91 101 111 121 131 141 HBA_HORSE 2 VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR 142 SCOP domains d2mhba_ A: Hemoglobin, alpha-chain SCOP domains CATH domains 2mhbA00 A:1-141 Globins CATH domains Pfam domains -----Globin-2mhbA01 A:6-106 ----------------------------------- Pfam domains SAPs(SNPs) -----------------------F-----------------------------------Q--------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) -GLOBIN PDB: A:2-141 UniProt: 3-142 PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2mhb A 1 VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR 141 10 20 30 40 50 60 70 80 90 100 110 120 130 140 Chain B from PDB Type:PROTEIN Length:146 aligned with HBB_HORSE | P02062 from UniProtKB/Swiss-Prot Length:146 Alignment length:146 10 20 30 40 50 60 70 80 90 100 110 120 130 140 HBB_HORSE 1 VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH 146 SCOP domains d2mhbb_ B: Hemoglobin, beta-chain SCOP domains CATH domains 2mhbB00 B:1-146 Globins CATH domains Pfam domains ------Globin-2mhbB01 B:7-111 ----------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --GLOBIN PDB: B:3-146 UniProt: 3-146 PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2mhb B 1 VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH 146 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (HBA_HORSE | P01958)
Chain B (HBB_HORSE | P02062)
|
|
|
|
|
|
|