|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 8) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1G0B) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1G0B) |
SAPs(SNPs)/Variants (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 2)| Asymmetric Unit (1, 2) Biological Unit 1 (1, 4) |
Exons (0, 0)| (no "Exon" information available for 1G0B) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:141 aligned with HBA_HORSE | P01958 from UniProtKB/Swiss-Prot Length:142 Alignment length:141 11 21 31 41 51 61 71 81 91 101 111 121 131 141 HBA_HORSE 2 VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR 142 SCOP domains d1g0ba_ A: Hemoglobin, alpha-chain SCOP domains CATH domains 1g0bA00 A:1-141 Globins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----------------------F-----------------------------------Q--------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -GLOBIN PDB: A:2-141 UniProt: 3-142 PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1g0b A 1 VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSDLSNLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR 141 10 20 30 40 50 60 70 80 90 100 110 120 130 140 Chain B from PDB Type:PROTEIN Length:146 aligned with HBB_HORSE | P02062 from UniProtKB/Swiss-Prot Length:146 Alignment length:146 10 20 30 40 50 60 70 80 90 100 110 120 130 140 HBB_HORSE 1 VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH 146 SCOP domains d1g0bb_ B: Hemoglobin, beta-chain SCOP domains CATH domains 1g0bB00 B:1-146 Globins CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) --GLOBIN PDB: B:3-146 UniProt: 3-146 PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1g0b B 1 VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDKLHVDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVANALAHKYH 146 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric Unit |
CATH Domains (1, 2)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1G0B) |
Gene Ontology (8, 16)|
Asymmetric Unit(hide GO term definitions) Chain A (HBA_HORSE | P01958)
Chain B (HBB_HORSE | P02062)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|