|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MGR) |
Sites (0, 0)| (no "Site" information available for 2MGR) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2MGR) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2MGR) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MGR) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2MGR) |
Exons (0, 0)| (no "Exon" information available for 2MGR) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:99 aligned with MSP1_PLAYO | P13828 from UniProtKB/Swiss-Prot Length:1772 Alignment length:99 1665 1675 1685 1695 1705 1715 1725 1735 1745 MSP1_PLAYO 1656 GVDPKHVCVDTRDIPKNAGCFRDDNGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS 1754 SCOP domains d2mgra1 A:1-48 d2mgra2 A:49-99 Merozoite surface protein 1 (MSP-1) SCOP domains CATH domains --------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2mgr A 1 GVDPKHVCVDTRDIPKNAGCFRDDDGTKEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS 99 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MGR) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MGR) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A (MSP1_PLAYO | P13828)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|