|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2M5W) |
Sites (0, 0)| (no "Site" information available for 2M5W) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2M5W) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2M5W) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2M5W) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2M5W) |
Exons (0, 0)| (no "Exon" information available for 2M5W) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:91 aligned with Q54TG6_DICDI | Q54TG6 from UniProtKB/TrEMBL Length:354 Alignment length:91 10 20 30 40 50 60 70 80 90 Q54TG6_DICDI 1 MSEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLITEALKKSTRLQVSEDGKMVRRLDPLPENID 91 SCOP domains d2m5wa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 2m5w A 1 MSEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLITEALKKSTRLQVSEDGKMVRRLDPLPENID 91 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2M5W) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2M5W) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (Q54TG6_DICDI | Q54TG6)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|