2LNB - JenaLib

Title :   SOLUTION NMR STRUCTURE OF N-TERMINAL DOMAIN (6-74) OF HUMAN ZBP1 PROTEIN, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR8174A.

Authors :   Y. Yang, T. A. Ramelot, K. Hamilton, E. Kohan, D. Wang, T. B. Acton, R. Xia J. K. Everett, G. T. Montelione, M. A. Kennedy, Northeast Structural Consortium (Nesg)

Date :   20 Dec 11 (Deposition) - 18 Jan 12 (Release) - 18 Jan 12 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)
NMR Structure *: A  (1x)

Keywords :   Structural Genomics, Northeast Structural Genomics Consortium (Nesg), Psi-Biology, Protein Structure Initiative, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Yang, T. A. Ramelot, K. Hamilton, E. Kohan, D. Wang, T. B. Acton, R. Xiao, J. K. Everett, G. T. Montelione, M. A. Kennedy
Solution Nmr Structure Of N-Terminal Domain (6-74) Of Human Zbp1 Protein, Northeast Structural Genomics Consortium Target Hr8174A
To Be Published
PubMed: search

Compounds

Molecule 1 - Z-DNA-BINDING PROTEIN 1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3)PMGK
	Expression System Taxid	:	469008
	Expression System Vector	:	PET15
	Fragment	:	DRADA 1 REPEAT REGION, RESIDUES 6-74
	Gene	:	C20ORF183, DLM1, ZBP1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TUMOR STROMA AND ACTIVATED MACROPHAGE PROTEIN DLM-1

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

NMR Structure (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_057030	R	17	I	ZBP1_HUMAN	Polymorphism	35813125	A	R	23	I
2	UniProt	VAR_061728	K	53	R	ZBP1_HUMAN	Polymorphism	35895307	A	K	59	R
3	UniProt	VAR_057031	G	70	R	ZBP1_HUMAN	Polymorphism	34964609	A	G	76	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_057030	R	17	I	ZBP1_HUMAN	Polymorphism	35813125	A	R	23	I
2	UniProt	VAR_061728	K	53	R	ZBP1_HUMAN	Polymorphism	35895307	A	K	59	R
3	UniProt	VAR_057031	G	70	R	ZBP1_HUMAN	Polymorphism	34964609	A	G	76	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:80
 aligned with ZBP1_HUMAN | Q9H171 from UniProtKB/Swiss-Prot  Length:429

    Alignment length:80
                                5      6                                                                    
                                |    - |      14        24        34        44        54        64        74
            ZBP1_HUMAN    1 MAQAP------ADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE 74
               SCOP domains d2lnba_ A: automated matches                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh........hhhhhhhhhhhhhhhhhh..eehhhhhhhhh.hhhhhhhhhhhhhhh..eeeee..eeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------I-----------------------------------R----------------R---- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                  2lnb A  1 MGHHHHHHSHMADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPE 80
                                    10        20        30        40        50        60        70        80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (12, 12)

NMR Structure(hide GO term definitions)

Chain A (ZBP1_HUMAN | Q9H171)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003726	double-stranded RNA adenosine deaminase activity	Catalysis of the reaction: adenosine + H2O = inosine + NH3, in a double-stranded RNA molecule.
	GO:0003692	left-handed Z-DNA binding	Interacting selectively and non-covalently with DNA in the Z form, i.e. a left-handed helix in which the phosphate backbone zigzags.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008150	biological_process	Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0032481	positive regulation of type I interferon production	Any process that activates or increases the frequency, rate, or extent of type I interferon production. Type I interferons include the interferon-alpha, beta, delta, episilon, zeta, kappa, tau, and omega gene families.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2lnb)

	Sites
(no "Sites" information available for 2lnb)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2lnb)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2lnb
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ZBP1_HUMAN \| Q9H171
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ZBP1_HUMAN \| Q9H171
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description