Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF THE ECD1 OF CRF-R1 IN COMPLEX WITH A PEPTIDE AGONIST
 
Authors :  C. R. R. Grace, M. H. Perrin, J. R. R. Gulyas, J. E. Rivier, W. W. Vale, R. R.
Date :  12 Aug 10  (Deposition) - 01 Sep 10  (Release) - 01 Mar 17  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (20x)
NMR Structure *:  A,B  (1x)
Keywords :  Crf, Ecd1, Agonist, Family B1, Alpha Helical Crf, Membrane Protein, Peptide Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. R. Grace, M. H. Perrin, J. Gulyas, J. E. Rivier, W. W. Vale, R. Riek
Nmr Structure Of The First Extracellular Domain Of Corticotropin-Releasing Factor Receptor 1 (Ecd1-Crf-R1) Complexed With A High Affinity Agonist.
J. Biol. Chem. V. 285 38580 2010
PubMed-ID: 20843795  |  Reference-DOI: 10.1074/JBC.M110.121897

(-) Compounds

Molecule 1 - CORTICOTROPIN-RELEASING FACTOR RECEPTOR 1
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-32A(+)(NOVAGEN)
    Expression System Taxid562
    FragmentRESIDUES 28-111
    GeneCRHR1, CRFR, CRFR1, CRHR
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCRF-R-1, CRF-R1, CRFR-1, CORTICOTROPIN-RELEASING HORMONE RECEPTOR 1, CRH-R-1, CRH-R1
 
Molecule 2 - PEPTIDE AGONIST
    ChainsB
    EngineeredYES
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
NMR Structure (20x)AB
NMR Structure * (1x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2L27)

(-) Sites  (0, 0)

(no "Site" information available for 2L27)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:130 -A:154
2A:144 -A:187
3A:168 -A:202

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2L27)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2L27)

(-) PROSITE Motifs  (2, 2)

NMR Structure (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F2_3PS50227 G-protein coupled receptors family 2 profile 1.CRFR1_HUMAN29-106  1A:129-206
2G_PROTEIN_RECEP_F2_1PS00649 G-protein coupled receptors family 2 signature 1.CRFR1_HUMAN44-69  1A:144-169
NMR Structure * (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1G_PROTEIN_RECEP_F2_3PS50227 G-protein coupled receptors family 2 profile 1.CRFR1_HUMAN29-106  1A:129-206
2G_PROTEIN_RECEP_F2_1PS00649 G-protein coupled receptors family 2 signature 1.CRFR1_HUMAN44-69  1A:144-169

(-) Exons   (0, 0)

(no "Exon" information available for 2L27)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:84
 aligned with CRFR1_HUMAN | P34998 from UniProtKB/Swiss-Prot  Length:444

    Alignment length:84
                                    34        44        54        64        74        84        94       104    
          CRFR1_HUMAN    25 LQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNE 108
               SCOP domains ------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhh.....................................................ee...ee....hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ----G_PROTEIN_RECEP_F2_3  PDB: A:129-206 UniProt: 29-106                          -- PROSITE (1)
                PROSITE (2) -------------------G_PROTEIN_RECEP_F2_1      --------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 2l27 A 125 LQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNE 208
                                   134       144       154       164       174       184       194       204    

Chain B from PDB  Type:PROTEIN  Length:38
                                                                      
               SCOP domains -------------------------------------- SCOP domains
               CATH domains -------------------------------------- CATH domains
               Pfam domains -------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------- PROSITE
                 Transcript -------------------------------------- Transcript
                 2l27 B 304 PPISLDLTFNLLREVLEIAKAEQEAEEAAKNRLLLEEA 341
                                   313       323       333        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2L27)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2L27)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2L27)

(-) Gene Ontology  (24, 32)

NMR Structure(hide GO term definitions)
Chain A   (CRFR1_HUMAN | P34998)
molecular function
    GO:0004930    G-protein coupled receptor activity    Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
    GO:0015056    corticotrophin-releasing factor receptor activity    Combining with the corticotrophin-releasing factor family of ligands, including the urocortins, to initiate a change in cell activity.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    GO:0004888    transmembrane signaling receptor activity    Combining with an extracellular or intracellular signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity or state as part of signal transduction.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0007190    activation of adenylate cyclase activity    Any process that initiates the activity of the inactive enzyme adenylate cyclase.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0071376    cellular response to corticotropin-releasing hormone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a corticotropin-releasing hormone stimulus. Corticotropin-releasing hormone is a peptide hormone involved in the stress response.
    GO:0051458    corticotropin secretion    The regulated release of corticotropin by a cell. Corticotropin hormone is a polypeptide hormone synthesized and secreted from corticotropes in the anterior lobe of the pituitary gland in response to corticotropin-releasing hormone (CRH) released by the hypothalamus.
    GO:0007565    female pregnancy    The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:1901386    negative regulation of voltage-gated calcium channel activity    Any process that stops, prevents or reduces the frequency, rate or extent of voltage-gated calcium channel activity.
    GO:0007567    parturition    The reproductive process in which the parent is separated from its offspring either by giving birth to live young or by laying eggs.
    GO:0010579    positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway    Any process that increases the frequency, rate or extent of adenylate cyclase (AC) activity that is an integral part of a G-protein coupled receptor signaling pathway.
    GO:0010578    regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway    Any process that modulates the frequency, rate or extent of adenylate cyclase (AC) activity that is an integral part of a G-protein coupled receptor signaling pathway.
    GO:2000852    regulation of corticosterone secretion    Any process that modulates the frequency, rate or extent of corticosterone secretion.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0031226    intrinsic component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having either part of their peptide sequence embedded in the hydrophobic region of the membrane or some other covalently attached group such as a GPI anchor that is similarly embedded in the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2l27)
 
  Sites
(no "Sites" information available for 2l27)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2l27)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2l27
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CRFR1_HUMAN | P34998
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CRFR1_HUMAN | P34998
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CRFR1_HUMAN | P349983ehs 3eht 3ehu 4k5y 4z9g

(-) Related Entries Specified in the PDB File

2jnc NMR STRUCTURE OF ECD1 OF CRF-R2B
2jnd NMR STRUCTURE OF ECD1 OF CRF-R2B IN COMPLEX WITH ASTRESSIN