2KMF - JenaLib

Title :   SOLUTION STRUCTURE OF PSB27 FROM CYANOBACTERIAL PHOTOSYSTEM II

Authors :   P. D. Mabbitt, G. J. P. Rautureau, C. L. Day, S. M. Wilbanks, J. J. Eaton- Rye, M. G. Hinds

Date :   28 Jul 09 (Deposition) - 08 Sep 09 (Release) - 29 Sep 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Psb27, Photosystem Ii, Structure, Helical Bundle, Cyanobacteria, Photosynthesis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. D. Mabbitt, G. J. Rautureau, C. L. Day, S. M. Wilbanks, J. J. Eaton-Rye, M. G. Hinds
Solution Structure Of Psb27 From Cyanobacterial Photosystem Ii
Biochemistry V. 48 8771 2009
PubMed-ID: 19697958 | Reference-DOI: 10.1021/BI901309C
(for further references see the PDB file header)

Compounds

Molecule 1 - PHOTOSYSTEM II 11 KDA PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX-6P-3
	Expression System Strain	:	BL21
	Expression System Taxid	:	562
	Expression System Variant	:	DE3
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 25-134
	Gene	:	PSB27
	Organism Scientific	:	SYNECHOCYSTIS SP.
	Organism Taxid	:	1148
	Strain	:	PCC 6803

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:115
 aligned with PSB27_SYNY3 | P74367 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:115
                             22                                                                                                                
                           21 |                                                                                                                
                            | |     29        39        49        59        69        79        89        99       109       119       129     
          PSB27_SYNY3    21 G-LTACDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV 134
               SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..............hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                 2kmf A  -4 GPLGSCDSGTGLTGNYSQDTLTVIATLREAIDLPQDAPNRQEVQDTARGQINDYISRYRRKGDAGGLKSFTTMQTALNSLAGYYTSYGARPIPEKLKKRLQLEFTQAERSIERGV 110
                                     5        15        25        35        45        55        65        75        85        95       105

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

NMR Structure(hide GO term definitions)

Chain A (PSB27_SYNY3 | P74367)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0010207	photosystem II assembly	The aggregation, arrangement and bonding together of a set of components to form a photosystem II complex on the thylakoid membrane. The photosystem II complex consists of at least 20 polypeptides and around 80 cofactors in most organisms.
	GO:0010206	photosystem II repair	Proteolysis of the damaged D1 protein and re-assembly of a new D1 subunit in the photosystem II following photoinhibition.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0030096	plasma membrane-derived thylakoid photosystem II	A protein complex, located in the membrane-derived thylakoid, containing the P680 reaction center. In the light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0031977	thylakoid lumen	The volume enclosed by a thylakoid membrane.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kmf)

	Sites
(no "Sites" information available for 2kmf)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kmf)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2kmf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PSB27_SYNY3 \| P74367
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PSB27_SYNY3 \| P74367
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description