Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  REFINED SOLUTION STRUCTURE OF METHANOSARCINA THERMOPHILA PROTEIN MC1
 
Authors :  F. Paquet, H. Meudal, F. Culard, G. Lancelot
Date :  08 Apr 09  (Deposition) - 12 May 09  (Release) - 22 Oct 14  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (15x)
NMR Structure *:  A  (1x)
Keywords :  Dna-Binding Protein, Alpha And Beta, Dna-Binding, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Paquet, K. Loth, H. Meudal, F. Culard, D. Genest, G. Lancelot
Refined Solution Structure And Backbone Dynamics Of The Archaeal Mc1 Protein
Febs J. V. 277 5133 2010
PubMed-ID: 21078128  |  Reference-DOI: 10.1111/J.1742-4658.2010.07927.X

(-) Compounds

Molecule 1 - CHROMOSOMAL PROTEIN MC1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Variant: DE3
    Expression System Vector: PET24A-MC1
    Expression System Vector Type: VECTOR
    Organism Scientific: METHANOSARCINA THERMOPHILA
    Organism Taxid: 2210
    Strain: CHTI 55

 Structural Features

(-) Chains, Units

  1
NMR Structure (15x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2KHL)

(-) Sites  (0, 0)

(no "Site" information available for 2KHL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2KHL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2KHL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2KHL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2KHL)

(-) Exons   (0, 0)

(no "Exon" information available for 2KHL)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:93
 aligned with HMC1_METTE | P12770 from UniProtKB/Swiss-Prot  Length:93

    Alignment length:93
                                    10        20        30        40        50        60        70        80        90   
            HMC1_METTE    1 SNTRNFVLRDEDGNEHGVFTGKQPRQAALKAANRGSGTKANPDIIRLRERGTKKVHVFKAWKEIVDAPKNRPAWMPEKISKPFVKKERIEKLE 93
               SCOP domains d2khla_ A: Chromosomal protein MC1                                                            SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains MC1-2khlA01 A:1-93                                                                            Pfam domains
         Sec.struct. author ...eeeeee.....eeeeeee.hhhhhhhhhhh.........eeeeeee....eeeeeeeee...................eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------- Transcript
                  2khl A  1 SNTRNFVLRDEDGNEHGVFTGKQPRQAALKAANRGSGTKANPDIIRLRERGTKKVHVFKAWKEIVDAPKNRPAWMPEKISKPFVKKERIEKLE 93
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2KHL)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: MC1] (2)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (HMC1_METTE | P12770)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0042262    DNA protection    Any process in which DNA is protected from damage by, for example, oxidative stress.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2khl)
 
  Sites
(no "Sites" information available for 2khl)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2khl)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2khl
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HMC1_METTE | P12770
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HMC1_METTE | P12770
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HMC1_METTE | P12770: 1t23 2nbj

(-) Related Entries Specified in the PDB File

1t23