|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2KFV) |
Sites (0, 0)| (no "Site" information available for 2KFV) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2KFV) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2KFV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2KFV) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2KFV) |
Exons (3, 3)
NMR Structure (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:73 aligned with FKBP3_HUMAN | Q00688 from UniProtKB/Swiss-Prot Length:224 Alignment length:73 10 20 30 40 50 60 70 FKBP3_HUMAN 1 MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFK 73 SCOP domains ------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------- PROSITE Transcript 1 Exon 1.2b PDB: A:20-55 Exon 1.3 PDB: A:56-89 1.4 Transcript 1 2kfv A 20 MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFK 92 29 39 49 59 69 79 89
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2KFV) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2KFV) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2KFV) |
Gene Ontology (10, 10)|
NMR Structure(hide GO term definitions) Chain A (FKBP3_HUMAN | Q00688)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|