Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF CRCVNH (C. RICHARDII CVNH)
 
Authors :  L. M. I. Koharudin, A. R. Viscomi, J. Jee, S. Ottonello, A. M. Gronenborn
Date :  09 Jan 08  (Deposition) - 25 Mar 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (30x)
Keywords :  Cvnh, Nmr, Antiviral Protein, Carbohydrate Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. M. Koharudin, A. R. Viscomi, J. G. Jee, S. Ottonello, A. M. Gronenborn
The Evolutionarily Conserved Family Of Cyanovirin-N Homologs: Structures And Carbohydrate Specificity.
Structure V. 16 570 2008
PubMed-ID: 18400178  |  Reference-DOI: 10.1016/J.STR.2008.01.015
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYANOVIRIN-N HOMOLOG
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET22B
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: CERATOPTERIS RICHARDII
    Organism Taxid: 49495
    Synonym: CYANOVIRIN-N-LIKE PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (30x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JZJ)

(-) Sites  (0, 0)

(no "Site" information available for 2JZJ)

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:3 -A:102
2A:9 -A:23
3A:59 -A:74

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JZJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JZJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JZJ)

(-) Exons   (0, 0)

(no "Exon" information available for 2JZJ)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:116
 aligned with CVNH_CERRI | P86326 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:116
                                    36        46        56        66        76        86        96       106       116       126       136      
           CVNH_CERRI    27 AQCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE 142
               SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------------------------CVNH-2jzjA01 A:54-116                                           Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------CVNH-2jzjA02 A:54-116                                           Pfam domains (2)
         Sec.struct. author ...hhhh.eeeeeee..eeeeeee.....eeeeeee.hhh.eee..eee.........eeeeeee...eeeeeee.....eeeeeee.hhh.eee..eee................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 2jzj A   1 MQCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE 116
                                    10        20        30        40        50        60        70        80        90       100       110      


Chain A from PDB  Type:PROTEIN  Length:116
 aligned with D0VWW7_CERRI | D0VWW7 from UniProtKB/TrEMBL  Length:124

    Alignment length:116
                                    10        20        30        40        50        60        70        80        90       100       110      
         D0VWW7_CERRI     1 MQCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE 116
               SCOP domains -------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------------------------CVNH-2jzjA01 A:54-116                                           Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------CVNH-2jzjA02 A:54-116                                           Pfam domains (2)
         Sec.struct. author ...hhhh.eeeeeee..eeeeeee.....eeeeeee.hhh.eee..eee.........eeeeeee...eeeeeee.....eeeeeee.hhh.eee..eee................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------- Transcript
                 2jzj A   1 MQCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE 116
                                    10        20        30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2JZJ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JZJ)

(-) Pfam Domains  (1, 2)

NMR Structure
(-)
Clan: no clan defined [family: CVNH] (11)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (D0VWW7_CERRI | D0VWW7)

Chain A   (CVNH_CERRI | P86326)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jzj)
 
  Sites
(no "Sites" information available for 2jzj)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jzj)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jzj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CVNH_CERRI | P86326
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  D0VWW7_CERRI | D0VWW7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CVNH_CERRI | P86326
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  D0VWW7_CERRI | D0VWW7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2JZJ)

(-) Related Entries Specified in the PDB File

2jzk 2jzl