Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF TBCVNH (T. BORCHII CVNH) (CASP TARGET)
 
Authors :  L. M. I. Koharudin, A. R. Viscomi, J. Jee, S. Ottonello, A. M. Gronenborn
Date :  09 Jan 08  (Deposition) - 25 Mar 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (30x)
Keywords :  Cvnh, Nmr, Antiviral Protein, Carbohydrate Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. M. Koharudin, A. R. Viscomi, J. G. Jee, S. Ottonello, A. M. Gronenborn
The Evolutionarily Conserved Family Of Cyanovirin-N Homologs: Structures And Carbohydrate Specificity.
Structure V. 16 570 2008
PubMed-ID: 18400178  |  Reference-DOI: 10.1016/J.STR.2008.01.015
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYANOVIRIN-N HOMOLOG
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET15B
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonWHITISH TRUFFLE
    Organism ScientificTUBER BORCHII
    Organism Taxid42251
    SynonymCYANOVIRIN-N-LIKE PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure (30x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JZK)

(-) Sites  (0, 0)

(no "Site" information available for 2JZK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JZK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JZK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JZK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JZK)

(-) Exons   (0, 0)

(no "Exon" information available for 2JZK)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:103
 aligned with CVNH_TUBBO | Q5MK11 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
           CVNH_TUBBO     1 MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTCIGNPNGFLGWGMQNFSHSSEDIKLEEGGRKLTCRPKTVDGGFRERQGIDLNRIQNVNGRLVFQ 103
               SCOP domains d2jzka_ A: automated matches                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -CVNH-2jzkA01 A:2-102                                                                                 - Pfam domains
         Sec.struct. author .hhhh.eeeeeee....eeeeeee.....eeeeeee....ee......ee...hhhh.eeeeee.....eeeeee..........eeee...eeee..eeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 2jzk A   1 MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTCIGNPNGFLGWGMQNFSHSSEDIKLEEGGRKLTCRPKTVDGGFRERQGIDLNRIQNVNGRLVFQ 103
                                    10        20        30        40        50        60        70        80        90       100   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JZK)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (CVNH_TUBBO | Q5MK11)
molecular function
    GO:0030246    carbohydrate binding    Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jzk)
 
  Sites
(no "Sites" information available for 2jzk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jzk)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jzk
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CVNH_TUBBO | Q5MK11
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CVNH_TUBBO | Q5MK11
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CVNH_TUBBO | Q5MK112kjl 3hnu 3hnx 3hp8

(-) Related Entries Specified in the PDB File

2jzj 2jzl