|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 10)
NMR Structure (1, 10)
|
Sites (10, 10)
NMR Structure (10, 10)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2JU4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JU4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JU4) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JU4) |
Exons (3, 3)
NMR Structure (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:87 aligned with CNRG_BOVIN | P04972 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 CNRG_BOVIN 1 MNLEPPKAEIRSATRVMGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII 87 SCOP domains --------------------------------------------------------------------------------------- SCOP domains CATH domains 2ju4A00 A:1-86 Intrinsically disordered gamma-subunit of cGMP phosphodiesterase - CATH domains Pfam domains ----PDE6_gamma-2ju4A01 A:5-86 - Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.1 PDB: A:1-61 UniProt: 1-61 -------------Exon 1.3 Transcript 1 (1) Transcript 1 (2) ------------------------------------------------------------Exon 1.2 ------------ Transcript 1 (2) 2ju4 A 1 MNLEPPKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGCGDDIPGMEGCGTDITVICPWEACNHCELHELAQYGIC 87 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2JU4) |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (11, 11)|
NMR Structure(hide GO term definitions) Chain A (CNRG_BOVIN | P04972)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|