|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2J5Y) |
(no "Site" information available for 2J5Y) |
(no "SS Bond" information available for 2J5Y) |
(no "Cis Peptide Bond" information available for 2J5Y) |
(no "SAP(SNP)/Variant" information available for 2J5Y) |
(no "PROSITE Motif" information available for 2J5Y) |
(no "Exon" information available for 2J5Y) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:61 aligned with PAB_FINMA | Q51911 from UniProtKB/Swiss-Prot Length:387 Alignment length:78 197 207 217 227 237 247 257 PAB_FINMA 188 VLSREEAETPKKPEEKKPEDKRPKMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA 265 SCOP domains d2j5 ya_ A: automated matches SCOP domains CATH domains 2j5y A00 A:-7-53 Albumin-binding domain CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 2j5y A -7 LVPR-----------------GSHMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA 53 | - - | 5 15 25 35 45 -4 -3 Chain B from PDB Type:PROTEIN Length:61 aligned with PAB_FINMA | Q51911 from UniProtKB/Swiss-Prot Length:387 Alignment length:78 197 207 217 227 237 247 257 PAB_FINMA 188 VLSREEAETPKKPEEKKPEDKRPKMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA 265 SCOP domains d2j5 yb_ B: automated matches SCOP domains CATH domains 2j5y B00 B:-7-53 Albumin-binding domain CATH domains Pfam domains ------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------ Transcript 2j5y B -7 LVPR-----------------GSHMTIDQWLLKNAKEDAIAELKKAGITSDFYFNAINKAKTVEEVNALKNEILKAHA 53 | - - | 5 15 25 35 45 -4 -3
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 2J5Y) |
Asymmetric Unit(hide GO term definitions) Chain A,B (PAB_FINMA | Q51911)
|
|
|
|
|
|
|