|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2IKD) |
Sites (0, 0)| (no "Site" information available for 2IKD) |
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2IKD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2IKD) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2IKD) |
Exons (0, 0)| (no "Exon" information available for 2IKD) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:56 aligned with Q2FAY5_MANSE | Q2FAY5 from UniProtKB/TrEMBL Length:441 Alignment length:56 29 39 49 59 69 Q2FAY5_MANSE 20 QACTLPNNDKGTCKSLLQCDVASKIISKKPRTAQDEKFLRESACGFDGQTPKVCCP 75 SCOP domains -------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 2ikd A 11 QACTLPNNDKGTCKSLLQCDVASKIISKKPRTAQDEKFLRESACGFDGQTPKVCCP 66 20 30 40 50 60 Chain A from PDB Type:PROTEIN Length:56 aligned with Q8I917_MANSE | Q8I917 from UniProtKB/TrEMBL Length:441 Alignment length:56 29 39 49 59 69 Q8I917_MANSE 20 QACTLPNNDKGTCKSLLQCDVASKIISKKPRTAQDEKFLRESACGFDGQTPKVCCP 75 SCOP domains -------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 2ikd A 11 QACTLPNNDKGTCKSLLQCDVASKIISKKPRTAQDEKFLRESACGFDGQTPKVCCP 66 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2IKD) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2IKD) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2IKD) |
Gene Ontology (5, 10)|
NMR Structure(hide GO term definitions) Chain A (Q8I917_MANSE | Q8I917)
Chain A (Q2FAY5_MANSE | Q2FAY5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|