2I6T - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   ORTHORHOMBIC STRUCTURE OF THE LDH DOMAIN OF HUMAN UBIQUITIN-CONJUGATING ENZYME E2-LIKE ISOFORM A

Authors :   J. R. Walker, G. V. Avvakumov, S. Xue, E. M. Newman, P. J. Finerty Jr. , C. Cole, W. Tempel, J. Weigelt, M. Sundstrom, C. H. Arrowsmith, A. M. Edwa A. Bochkarev, S. Dhe-Paganon

Date :   29 Aug 06 (Deposition) - 24 Oct 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)
Biol. Unit 2: A,B  (1x)

Keywords :   L-Lactate Dehydrogenase, Oxidoreductase, Ubiquitin-Protein Ligase, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. V. Avvakumov, J. R. Walker, S. Xue, E. M. Newman, P. J. Finerty Jr. , C. Butler-Cole, W. Tempel, J. Weigelt, M. Sundstrom, C. H. Arrowsmith A. M. Edwards, A. Bochkarev, S. Dhe-Paganon
Structural Investigation Into The L-Lactate Dehydrogenase Domain Of Human Ubiquitin-Conjugating Enzyme E2-Like Isofor A
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - UBIQUITIN-CONJUGATING ENZYME E2-LIKE ISOFORM A
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET28-LIC
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	L-LACTATE DEHYDROGENASE DOMAIN, RESIDUES 171-471
	Gene	:	UEVLD
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B
Biological Unit 2 (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 11)

No.	Name	Count	Type	Full Name
1	GOL	7	Ligand/Ion	GLYCEROL
2	SO4	4	Ligand/Ion	SULFATE ION

Biological Unit 1 (2, 22)

No.	Name	Count	Type	Full Name
1	GOL	14	Ligand/Ion	GLYCEROL
2	SO4	8	Ligand/Ion	SULFATE ION

Biological Unit 2 (2, 11)

No.	Name	Count	Type	Full Name
1	GOL	7	Ligand/Ion	GLYCEROL
2	SO4	4	Ligand/Ion	SULFATE ION

Asymmetric Unit (11, 11)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HIS A:282 , ALA A:336 , GLN A:337 , THR A:338 , SER A:339 , GLU A:362 , HOH A:497 , HOH A:549	BINDING SITE FOR RESIDUE SO4 A 1
02	AC2	SOFTWARE	HIS B:282 , ALA B:336 , GLN B:337 , THR B:338 , SER B:339 , GLU B:362 , HOH B:498	BINDING SITE FOR RESIDUE SO4 B 2
03	AC3	SOFTWARE	GOL B:8 , HIS B:282 , SER B:365 , SER B:368 , TYR B:418 , HOH B:494 , HOH B:507	BINDING SITE FOR RESIDUE SO4 B 3
04	AC4	SOFTWARE	GOL A:7 , HIS A:282 , VAL A:364 , SER A:365 , SER A:368 , TYR A:418 , HOH A:500 , HOH A:530 , HOH A:590	BINDING SITE FOR RESIDUE SO4 A 4
05	AC5	SOFTWARE	ILE B:317 , GLY B:318 , CYS B:319 , ASN B:320 , LEU B:321 , ASP B:322 , GLN B:385 , SER B:393	BINDING SITE FOR RESIDUE GOL B 5
06	AC6	SOFTWARE	ILE A:317 , GLY A:318 , CYS A:319 , ASN A:320 , LEU A:321 , ASP A:322 , GLN A:349 , GLN A:385 , SER A:393 , HOH A:544	BINDING SITE FOR RESIDUE GOL A 6
07	AC7	SOFTWARE	SO4 A:4 , PRO A:278 , GLY A:281 , HIS A:282 , SER A:307 , THR A:367 , SER A:368 , GLN A:371 , LYS A:443 , HOH A:500	BINDING SITE FOR RESIDUE GOL A 7
08	AC8	SOFTWARE	SO4 B:3 , PRO B:278 , GLY B:281 , HIS B:282 , SER B:307 , THR B:367 , SER B:368 , GLN B:371 , LYS B:443 , HOH B:494	BINDING SITE FOR RESIDUE GOL B 8
09	AC9	SOFTWARE	LYS A:238 , ASP A:239 , LEU A:240 , SER A:241 , VAL A:333 , LEU A:334 , ARG A:375 , HOH A:529	BINDING SITE FOR RESIDUE GOL A 9
10	BC1	SOFTWARE	ASP A:225 , ILE A:228 , PHE A:229 , HOH A:552 , LEU B:321 , GLN B:324 , LEU B:392 , SER B:393	BINDING SITE FOR RESIDUE GOL A 10
11	BC2	SOFTWARE	TYR A:418 , VAL A:441 , ILE A:442 , LYS A:443 , THR A:444 , HOH A:517 , HOH A:540 , HOH A:606	BINDING SITE FOR RESIDUE GOL A 11

(no "SS Bond" information available for 2I6T)

Asymmetric Unit

No.	Residues
1	Gln A:294	-	Pro A:295
2	Gln B:294	-	Pro B:295

(no "SAP(SNP)/Variant" information available for 2I6T)

(no "PROSITE Motif" information available for 2I6T)

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000396197	1	ENSE00001343027	chr11:18610281-18610160	122	UEVLD_HUMAN	1-14	14	0	-	-
1.2	ENST00000396197	2	ENSE00001150754	chr11:18600355-18600271	85	UEVLD_HUMAN	15-43	29	0	-	-
1.3	ENST00000396197	3	ENSE00001322441	chr11:18596959-18596894	66	UEVLD_HUMAN	43-65	23	0	-	-
1.4	ENST00000396197	4	ENSE00001106792	chr11:18591924-18591761	164	UEVLD_HUMAN	65-119	55	0	-	-
1.5	ENST00000396197	5	ENSE00001106800	chr11:18588029-18587894	136	UEVLD_HUMAN	120-165	46	0	-	-
1.6	ENST00000396197	6	ENSE00000997735	chr11:18586557-18586439	119	UEVLD_HUMAN	165-204	40	2	A:182-204 B:182-204	23 23
1.8	ENST00000396197	8	ENSE00000997734	chr11:18579877-18579775	103	UEVLD_HUMAN	205-239	35	2	A:205-239 (gaps) B:205-239 (gaps)	35 35
1.9	ENST00000396197	9	ENSE00000997739	chr11:18568597-18568427	171	UEVLD_HUMAN	239-296	58	2	A:239-296 (gaps) B:239-296 (gaps)	58 58
1.10	ENST00000396197	10	ENSE00000997736	chr11:18566343-18566170	174	UEVLD_HUMAN	296-354	59	2	A:296-354 B:296-354	59 59
1.11	ENST00000396197	11	ENSE00001210262	chr11:18558016-18557953	64	UEVLD_HUMAN	354-375	22	2	A:354-375 B:354-375	22 22
1.13	ENST00000396197	13	ENSE00001524205	chr11:18556000-18555877	124	UEVLD_HUMAN	375-416	42	2	A:375-416 B:375-416	42 42
1.14	ENST00000396197	14	ENSE00001790365	chr11:18554034-18553245	790	UEVLD_HUMAN	417-471	55	2	A:417-471 (gaps) B:417-471 (gaps)	55 55

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:280
 aligned with UEVLD_HUMAN | Q8IX04 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:290
                                   191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471
          UEVLD_HUMAN   182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL 471
               SCOP domains d2i6ta1 A:182-318 automated matches                                                                                                      d2i6ta2 A:319-471 automated matches                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhhhhhhhhhhhhhh...eeeee...-----hhhhhhhhh...eeee.hhhhhh...eeee....----.hhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhh....hhhh.eeee.......eeee.......hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh...eeeeeeee...........eeeeeeeee..eeeee.....-.hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6  PDB: A:182-20Exon 1.8  PDB: A:205-239 (gaps)    --------------------------------------------------------Exon 1.10  PDB: A:296-354 UniProt: 296-354                 --------------------Exon 1.13  PDB: A:375-416 UniProt: 375-416Exon 1.14  PDB: A:417-471 (gaps) UniProt: 417-471       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.9  PDB: A:239-296 (gaps) UniProt: 239-296          ---------------------------------------------------------Exon 1.11             ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2i6t A 182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLS-----ATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNS----QSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTL-EDTVTEKLQSSASSIHSLQQQLKL 471
                                   191       201       211    |    -|      231       241       251   |   261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441    | |451       461       471
                                                            216   222                              255  260                                                                                                                                                                                       446 |                       
                                                                                                                                                                                                                                                                                                    448

Chain B from PDB  Type:PROTEIN  Length:282
 aligned with UEVLD_HUMAN | Q8IX04 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:290
                                   191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471
          UEVLD_HUMAN   182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQSSASSIHSLQQQLKL 471
               SCOP domains d2i6tb1 B:182-318 automated matches                                                                                                      d2i6tb2 B:319-471 automated matches                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..hhhhhhhhhhhhhh....eeeee.....--hhhhhhhhh....eeee.hhhhhh...eeee....----.hhhhhhhhhhhhhhhhhhhhhhhh...eeee...hhhhhhhhhhhhhh.hhh.eee..hhhhhhhhhhhhhhh....hhhh.eeee.......eeee.......hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...eeeeeeee...........eeeeeeeee..eeeee......--.hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.6  PDB: B:182-20Exon 1.8  PDB: B:205-239 (gaps)    --------------------------------------------------------Exon 1.10  PDB: B:296-354 UniProt: 296-354                 --------------------Exon 1.13  PDB: B:375-416 UniProt: 375-416Exon 1.14  PDB: B:417-471 (gaps) UniProt: 417-471       Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------Exon 1.9  PDB: B:239-296 (gaps) UniProt: 239-296          ---------------------------------------------------------Exon 1.11             ------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 2i6t B 182 VNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEG--GATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNS----QSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGYYDINSEVFLSLPCILGTNGVSEVIKTTLK--TVTEKLQSSASSIHSLQQQLKL 471
                                   191       201       211      |221       231       241       251   |   261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441     | 451       461       471
                                                              218  |                               255  260                                                                                                                                                                                        447  |                     
                                                                 221                                                                                                                                                                                                                                  450

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: LDH C-terminal domain-like (172)

Superfamily: LDH C-terminal domain-like (172)

Family: automated matches (38)

Protein domain: automated matches (38)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d2i6ta2	A:319-471
1b	d2i6tb2	B:319-471

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: automated matches (447)

Protein domain: automated matches (447)

Human (Homo sapiens) [TaxId: 9606] (32)

2a	d2i6ta1	A:182-318
2b	d2i6tb1	B:182-318

(no "CATH Domain" information available for 2I6T)

(no "Pfam Domain" information available for 2I6T)

Asymmetric Unit(hide GO term definitions)

Chain A,B (UEVLD_HUMAN | Q8IX04)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0003674	molecular_function	Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group acts as a hydrogen or electron donor and reduces NAD+ or NADP.
biological process
	GO:0008150	biological_process	Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0019752	carboxylic acid metabolic process	The chemical reactions and pathways involving carboxylic acids, any organic acid containing one or more carboxyl (COOH) groups or anions (COO-).
	GO:0006464	cellular protein modification process	The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gln A:294 - Pro A:295	[ RasMol ]
		Gln B:294 - Pro B:295	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2i6t
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UEVLD_HUMAN \| Q8IX04
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	UEVLD_HUMAN \| Q8IX04
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	UEVLD_HUMAN \| Q8IX04	:	3dl2

(no "Related Entries Specified in the PDB File" available for 2I6T)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 11)

Sites (11, 11)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File