2I46 - JenaLib

Asymmetric/Biological Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000393919	1c	ENSE00001870586	chr16:67694646-67694025	622	ACD_HUMAN	1-119	119	2	A:90-119 B:90-119	30 30
1.2a	ENST00000393919	2a	ENSE00001516932	chr16:67693948-67693806	143	ACD_HUMAN	120-167	48	2	A:120-167 B:120-167 (gaps)	48 48
1.3a	ENST00000393919	3a	ENSE00000690384	chr16:67693698-67693605	94	ACD_HUMAN	167-198	32	2	A:167-198 B:167-198 (gaps)	32 32
1.3c	ENST00000393919	3c	ENSE00000690377	chr16:67693516-67693440	77	ACD_HUMAN	199-224	26	2	A:199-224 B:199-224	26 26
1.4	ENST00000393919	4	ENSE00000690362	chr16:67693322-67693278	45	ACD_HUMAN	224-239	16	2	A:224-239 B:224-239	16 16
1.5	ENST00000393919	5	ENSE00000690346	chr16:67693166-67693132	35	ACD_HUMAN	239-251	13	2	A:239-241 B:239-241	3 3
1.6	ENST00000393919	6	ENSE00000690328	chr16:67692982-67692831	152	ACD_HUMAN	251-301	51	0	-	-
1.7	ENST00000393919	7	ENSE00000844203	chr16:67692719-67692623	97	ACD_HUMAN	302-334	33	0	-	-
1.8	ENST00000393919	8	ENSE00000844204	chr16:67692544-67692458	87	ACD_HUMAN	334-363	30	0	-	-
1.9	ENST00000393919	9	ENSE00000844205	chr16:67692265-67691889	377	ACD_HUMAN	363-488	126	0	-	-
1.10	ENST00000393919	10	ENSE00000690315	chr16:67691756-67691665	92	ACD_HUMAN	489-519	31	0	-	-
1.11a	ENST00000393919	11a	ENSE00001943501	chr16:67691587-67691435	153	ACD_HUMAN	519-544	26	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:152
 aligned with ACD_HUMAN | Q96AP0 from UniProtKB/Swiss-Prot  Length:544

    Alignment length:152
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229       239  
            ACD_HUMAN    90 SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEH 241
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhh.......eeeeeeeeee...................eeeeee....eeeeeehhhhhhh...............eeeeeeeeeeeee........eeeeeeeeeeeeeee.......hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1c  PDB: A:90-119      Exon 1.2a  PDB: A:120-167 UniProt: 120-167      -------------------------------Exon 1.3c  PDB: A:199-224 --------------1.5 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------Exon 1.3a  PDB: A:167-198       -------------------------Exon 1.4        -- Transcript 1 (2)
                 2i46 A  90 SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEH 241
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229       239

Chain B from PDB  Type:PROTEIN  Length:134
 aligned with ACD_HUMAN | Q96AP0 from UniProtKB/Swiss-Prot  Length:544

    Alignment length:152
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229       239  
            ACD_HUMAN    90 SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEH 241
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhh.......eeeeeeeeee...--------------..eeeeee....eeeeeehhhhhhh...----........eeeeeeeeeeeee........eeeeeeeeeeeeeee.......hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1c  PDB: B:90-119      Exon 1.2a  PDB: B:120-167 (gaps)                -------------------------------Exon 1.3c  PDB: B:199-224 --------------1.5 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------Exon 1.3a  PDB: B:167-198 (gaps)-------------------------Exon 1.4        -- Transcript 1 (2)
                 2i46 B  90 SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAE--------------VGATLLVSDGTHSVRCLVTREALDTSDW----FGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEH 241
                                    99       109       119     |   -         -|      149       159       | -  |    179       189       199       209       219       229       239  
                                                             125            140                        167  172

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (29, 29)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (ACD_HUMAN | Q96AP0)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0070182	DNA polymerase binding	Interacting selectively and non-covalently with a DNA polymerase.
	GO:0044877	macromolecular complex binding	Interacting selectively and non-covalently with any macromolecular complex.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042162	telomeric DNA binding	Interacting selectively and non-covalently with a telomere, a specific structure at the end of a linear chromosome required for the integrity and maintenance of the end.
biological process
	GO:0030326	embryonic limb morphogenesis	The process, occurring in the embryo, by which the anatomical structures of the limb are generated and organized. A limb is an appendage of an animal used for locomotion or grasping.
	GO:0070200	establishment of protein localization to telomere	The directed movement of a protein to a specific location in the telomeric region of a chromosome.
	GO:0006886	intracellular protein transport	The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
	GO:0032211	negative regulation of telomere maintenance via telomerase	Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of telomeric repeats by telomerase.
	GO:0060381	positive regulation of single-stranded telomeric DNA binding	Any process that increases the frequency, rate or extent of single-stranded telomeric DNA binding.
	GO:0051973	positive regulation of telomerase activity	Any process that activates or increases the frequency, rate or extent of telomerase activity, the catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
	GO:0032212	positive regulation of telomere maintenance via telomerase	Any process that activates or increases the frequency, rate or extent of the addition of telomeric repeats by telomerase.
	GO:0031848	protection from non-homologous end joining at telomere	A process that prevents non-homologous end joining at telomere, thereby ensuring that telomeres do not fuse.
	GO:0070198	protein localization to chromosome, telomeric region	Any process in which a protein is transported to, or maintained at, the telomeric region of a chromosome.
	GO:0035282	segmentation	The regionalization process that divides an organism or part of an organism into a series of semi-repetitive parts, or segments, often arranged along a longitudinal axis.
	GO:0001501	skeletal system development	The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
	GO:0032202	telomere assembly	A cellular process that results in the aggregation, arrangement and bonding together of a set of components to form a telomere at a non-telomeric double-stranded DNA end. A telomere is a terminal region of a linear chromosome that includes telomeric DNA repeats and associated proteins.
	GO:0016233	telomere capping	A process in which telomeres are protected from degradation and fusion, thereby ensuring chromosome stability by protecting the ends from both degradation and from being recognized as damaged DNA. May be mediated by specific single- or double-stranded telomeric DNA binding proteins.
	GO:0000723	telomere maintenance	Any process that contributes to the maintenance of proper telomeric length and structure by affecting and monitoring the activity of telomeric proteins, the length of telomeric DNA and the replication and repair of the DNA. These processes includes those that shorten, lengthen, replicate and repair the telomeric DNA sequences.
	GO:0007004	telomere maintenance via telomerase	The maintenance of proper telomeric length by the addition of telomeric repeats by telomerase.
	GO:0001655	urogenital system development	The process whose specific outcome is the progression of the urogenital system over time, from its formation to the mature structure.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000781	chromosome, telomeric region	The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0000783	nuclear telomere cap complex	A complex of DNA and protein located at the end of a linear chromosome in the nucleus that protects and stabilizes a linear chromosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0070187	shelterin complex	A nuclear telomere cap complex that is formed by the association of telomeric ssDNA- and dsDNA-binding proteins with telomeric DNA, and is involved in telomere protection and recruitment of telomerase. The complex is known to contain TERF1, TERF2, POT1, RAP1, TINF2 and ACD in mammalian cells, and Pot1, Tpz1, Rap1, Rif1, Rif2 and Taz1 in Schizosaccharomyces. Taz1 and Rap1 (or their mammalian equivalents) form a dsDNA-binding subcomplex, Pot1 and Tpz1 form an ssDNA-binding subcomplex, and the two subcomplexes are bridged by Poz1, which acts as an effector molecule along with Ccq1.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2i46
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACD_HUMAN \| Q96AP0
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (6, 12)