2I1Y - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE PHOSPHATASE DOMAIN OF HUMAN PTP IA-2

Authors :   J. Faber-Barata, Y. Patskovsky, J. Alvarado, D. Smith, J. Koss, S. R. Wa S. Ozyurt, S. Atwell, A. Powell, M. C. Kearins, M. Maletic, I. Rooney, K M. Freeman, J. C. Russell, D. A. Thompson, S. K. Burley, S. C. Almo, New Research Center For Structural Genomics (Nysgxrc)

Date :   15 Aug 06 (Deposition) - 29 Aug 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.23

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Receptor-Type Protein Tyrosine Phosphatase Precursor, Phosphatase, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. C. Almo, J. B. Bonanno, J. M. Sauder, S. Emtage, T. P. Dilorenzo, V. Malashkevich, S. R. Wasserman, S. Swaminathan, S. Eswaramoorthy, R. Agarwal, D. Kumaran, M. Madegowda, S. Ragumani, Y. Patskovsky, J. Alvarado, U. A. Ramagopal, J. Faber-Barata, M. R. Chance, A. Sali, A. Fiser, Z. Y. Zhang, D. S. Lawrence, S. K. Burley
Structural Genomics Of Protein Phosphatases
J. Struct. Funct. Genom. V. 8 121 2007
PubMed-ID: 18058037 | Reference-DOI: 10.1007/S10969-007-9036-1

Molecule 1 - RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE
	Chains	:	A, B
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21(DE3) CODON+ RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	TYROSINE-PROTEIN PHOSPHATASE
	Gene	:	PTPRN, ICA3, ICA512
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	R-PTP-N, PTP IA-2, ISLET CELL ANTIGEN 512, ICA 512, ISLET CELL AUTOANTIGEN 3

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	GOL	2	Ligand/Ion	GLYCEROL

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	GOL	1	Ligand/Ion	GLYCEROL

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LEU A:926 , MET A:929 , ALA A:930 , ILE A:973	BINDING SITE FOR RESIDUE GOL A 3288
2	AC2	SOFTWARE	LEU B:926 , MET B:929 , VAL B:970 , ILE B:973	BINDING SITE FOR RESIDUE GOL B 3287

(no "SS Bond" information available for 2I1Y)

Asymmetric Unit

No.	Residues
1	Glu A:722	-	Pro A:723
2	Glu B:722	-	Pro B:723

(no "SAP(SNP)/Variant" information available for 2I1Y)

Asymmetric Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPRN_HUMAN	709-969	2	A:709-969 B:709-969
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPRN_HUMAN	888-960	2	A:888-960 B:888-960
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPRN_HUMAN	907-917	2	A:907-917 B:907-917

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPRN_HUMAN	709-969	1	A:709-969 -
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPRN_HUMAN	888-960	1	A:888-960 -
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPRN_HUMAN	907-917	1	A:907-917 -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPRN_HUMAN	709-969	1	- B:709-969
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPRN_HUMAN	888-960	1	- B:888-960
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPRN_HUMAN	907-917	1	- B:907-917

Asymmetric Unit (10, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000295718	1b	ENSE00001843122	chr2:220174295-220173940	356	PTPRN_HUMAN	1-39	39	0	-	-
1.4c	ENST00000295718	4c	ENSE00001609781	chr2:220172564-220172514	51	PTPRN_HUMAN	39-56	18	0	-	-
1.4f	ENST00000295718	4f	ENSE00001646399	chr2:220172279-220172166	114	PTPRN_HUMAN	56-94	39	0	-	-
1.6b	ENST00000295718	6b	ENSE00001689890	chr2:220168553-220168457	97	PTPRN_HUMAN	94-126	33	0	-	-
1.7e	ENST00000295718	7e	ENSE00001669026	chr2:220167559-220167298	262	PTPRN_HUMAN	126-213	88	0	-	-
1.8c	ENST00000295718	8c	ENSE00001779946	chr2:220167213-220166859	355	PTPRN_HUMAN	214-332	119	0	-	-
1.9	ENST00000295718	9	ENSE00001803105	chr2:220166441-220166310	132	PTPRN_HUMAN	332-376	45	0	-	-
1.10	ENST00000295718	10	ENSE00001680212	chr2:220165699-220165665	35	PTPRN_HUMAN	376-387	12	0	-	-
1.11	ENST00000295718	11	ENSE00001790646	chr2:220164981-220164707	275	PTPRN_HUMAN	388-479	92	0	-	-
1.12	ENST00000295718	12	ENSE00001792556	chr2:220164508-220164422	87	PTPRN_HUMAN	479-508	30	0	-	-
1.13c	ENST00000295718	13c	ENSE00001663640	chr2:220164106-220164027	80	PTPRN_HUMAN	508-535	28	0	-	-
1.13d	ENST00000295718	13d	ENSE00001722334	chr2:220163833-220163769	65	PTPRN_HUMAN	535-556	22	0	-	-
1.14b	ENST00000295718	14b	ENSE00001641294	chr2:220162825-220162607	219	PTPRN_HUMAN	557-629	73	0	-	-
1.15b	ENST00000295718	15b	ENSE00001804219	chr2:220162155-220161955	201	PTPRN_HUMAN	630-696	67	2	A:691-696 B:687-696	6 10
1.16	ENST00000295718	16	ENSE00001596701	chr2:220161854-220161707	148	PTPRN_HUMAN	697-746	50	2	A:697-746 B:697-746	50 50
1.17a	ENST00000295718	17a	ENSE00001787617	chr2:220161544-220161471	74	PTPRN_HUMAN	746-770	25	2	A:746-770 B:746-770	25 25
1.18	ENST00000295718	18	ENSE00001642327	chr2:220161238-220161161	78	PTPRN_HUMAN	771-796	26	2	A:771-796 B:771-796	26 26
1.19a	ENST00000295718	19a	ENSE00001671885	chr2:220161067-220160948	120	PTPRN_HUMAN	797-836	40	2	A:797-836 B:797-836	40 40
1.19d	ENST00000295718	19d	ENSE00001770552	chr2:220159863-220159697	167	PTPRN_HUMAN	837-892	56	2	A:837-892 B:837-892	56 56
1.20b	ENST00000295718	20b	ENSE00001650195	chr2:220156245-220156192	54	PTPRN_HUMAN	892-910	19	2	A:892-910 B:892-910	19 19
1.21	ENST00000295718	21	ENSE00001687150	chr2:220155612-220155548	65	PTPRN_HUMAN	910-932	23	2	A:910-932 B:910-932	23 23
1.22	ENST00000295718	22	ENSE00001766807	chr2:220155333-220155260	74	PTPRN_HUMAN	932-956	25	2	A:932-956 B:932-956	25 25
1.23e	ENST00000295718	23e	ENSE00001775602	chr2:220155019-220154345	675	PTPRN_HUMAN	957-979	23	2	A:957-977 B:957-976	21 20

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:287
 aligned with PTPRN_HUMAN | Q16849 from UniProtKB/Swiss-Prot  Length:979

    Alignment length:287
                                   700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970       
          PTPRN_HUMAN   691 TGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKAL 977
               SCOP domains d2i1ya_ A: automated matches                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2i1yA00 A:691-977 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhh..hhhhh...............hhhhh........eeee.........eeee...hhhhhhhhhhhhhhhh..eeee....ee..ee..........eeee..eeeeeeeeee....eeeeeeeeee.....eeeeeeeee...........hhhhhhhhhhhhhh.......eeee....hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------TYR_PHOSPHATASE_PTP  PDB: A:709-969 UniProt: 709-969                                                                                                                                                                                                                 -------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:888-960 UniProt: 888-960                       ----------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA------------------------------------------------------------ PROSITE (3)
           Transcript 1 (1) 1.15b Exon 1.16  PDB: A:697-746 UniProt: 697-746        ------------------------Exon 1.18  PDB: A:771-796 Exon 1.19a  PDB: A:797-836              Exon 1.19d  PDB: A:837-892 UniProt: 837-892             -----------------Exon 1.21              ------------------------Exon 1.23e            Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------Exon 1.17a  PDB: A:746-77-------------------------------------------------------------------------------------------------------------------------Exon 1.20b         ---------------------Exon 1.22  PDB: A:932-956--------------------- Transcript 1 (2)
                 2i1y A 691 TGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKAL 977
                                   700       710       720       730       740       750       760       770       780       790       800       810       820       830       840       850       860       870       880       890       900       910       920       930       940       950       960       970

Chain B from PDB  Type:PROTEIN  Length:290
 aligned with PTPRN_HUMAN | Q16849 from UniProtKB/Swiss-Prot  Length:979

    Alignment length:290
                                   696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976
          PTPRN_HUMAN   687 MDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKA 976
               SCOP domains d2i1yb_ B: automated matches                                                                                                                                                                                                                                                                       SCOP domains
               CATH domains 2i1yB00 B:687-976 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhh...............hhhhh........eeee.........eeee...hhhhhhhhhhhhhhhh..eeee....ee..ee..........eeee..eeeeeeeeee....eeeeeeeeee.....eeeeeeeee...........hhhhhhhhhhhhh........eeee....hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------TYR_PHOSPHATASE_PTP  PDB: B:709-969 UniProt: 709-969                                                                                                                                                                                                                 ------- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:888-960 UniProt: 888-960                       ---------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.15bExon 1.16  PDB: B:697-746 UniProt: 697-746        ------------------------Exon 1.18  PDB: B:771-796 Exon 1.19a  PDB: B:797-836              Exon 1.19d  PDB: B:837-892 UniProt: 837-892             -----------------Exon 1.21              ------------------------Exon 1.23e           Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------Exon 1.17a  PDB: B:746-77-------------------------------------------------------------------------------------------------------------------------Exon 1.20b         ---------------------Exon 1.22  PDB: B:932-956-------------------- Transcript 1 (2)
                 2i1y B 687 MDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAILKA 976
                                   696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906       916       926       936       946       956       966       976

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: (Phosphotyrosine protein) phosphatases II (296)

Superfamily: (Phosphotyrosine protein) phosphatases II (296)

Family: automated matches (83)

Protein domain: automated matches (83)

Human (Homo sapiens) [TaxId: 9606] (76)

1a	d2i1ya_	A:
1b	d2i1yb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Protein-Tyrosine Phosphatase; Chain A (262)

Homologous Superfamily: Protein tyrosine phosphatase superfamily (228)

Human (Homo sapiens) (196)

1a	2i1yA00	A:691-977
1b	2i1yB00	B:687-976

(no "Pfam Domain" information available for 2I1Y)

Asymmetric Unit(hide GO term definitions)

Chain A,B (PTPRN_HUMAN | Q16849)

molecular function
	GO:0051020	GTPase binding	Interacting selectively and non-covalently with a GTPase, any enzyme that catalyzes the hydrolysis of GTP.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0030507	spectrin binding	Interacting selectively and non-covalently with spectrin, a protein that is the major constituent of the erythrocyte cytoskeletal network. It associates with band 4.1 (see band protein) and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane. It is composed of nonhomologous chains, alpha and beta, which aggregate side-to-side in an antiparallel fashion to form dimers, tetramers, and higher polymers.
biological process
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:1990502	dense core granule maturation	Steps required to transform a dense core granule generated at the trans-Golgi network into a fully formed and transmissible dense core granule. Dense core granule maturation proceeds through clathrin-mediated membrane remodeling events and is essential for efficient processing of cargo within dense core granules as well as for removing factors that might otherwise interfere with dense core granule trafficking and exocytosis.
	GO:0030073	insulin secretion	The regulated release of proinsulin from secretory granules (B granules) in the B cells of the pancreas; accompanied by cleavage of proinsulin to form mature insulin.
	GO:0035773	insulin secretion involved in cellular response to glucose stimulus	The regulated release of proinsulin from secretory granules (B granules) in the B cells of the pancreas; accompanied by cleavage of proinsulin to form mature insulin, in response to a glucose stimulus.
	GO:0001553	luteinization	The set of processes resulting in differentiation of theca and granulosa cells into luteal cells and in the formation of a corpus luteum after ovulation.
	GO:0051591	response to cAMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0043627	response to estrogen	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by an estrogen, C18 steroid hormones that can stimulate the development of female sexual characteristics.
	GO:0009749	response to glucose	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
	GO:0032868	response to insulin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
	GO:0000302	response to reactive oxygen species	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a reactive oxygen species stimulus. Reactive oxygen species include singlet oxygen, superoxide, and oxygen free radicals.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0043679	axon terminus	Terminal inflated portion of the axon, containing the specialized apparatus necessary to release neurotransmitters. The axon terminus is considered to be the whole region of thickening and the terminal button is a specialized region of it.
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0031410	cytoplasmic vesicle	A vesicle found in the cytoplasm of a cell.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0043204	perikaryon	The portion of the cell soma (neuronal cell body) that excludes the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0030141	secretory granule	A small subcellular vesicle, surrounded by a membrane, that is formed from the Golgi apparatus and contains a highly concentrated protein destined for secretion. Secretory granules move towards the periphery of the cell and upon stimulation, their membranes fuse with the cell membrane, and their protein load is exteriorized. Processing of the contained protein may take place in secretory granules.
	GO:0045202	synapse	The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.
	GO:0008021	synaptic vesicle	A secretory organelle, typically 50 nm in diameter, of presynaptic nerve terminals; accumulates in high concentrations of neurotransmitters and secretes these into the synaptic cleft by fusion with the 'active zone' of the presynaptic plasma membrane.
	GO:0030658	transport vesicle membrane	The lipid bilayer surrounding a transport vesicle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:722 - Pro A:723	[ RasMol ]
		Glu B:722 - Pro B:723	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2i1y
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PTPRN_HUMAN \| Q16849
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PTPRN_HUMAN \| Q16849
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PTPRN_HUMAN \| Q16849	:	2qt7 3n01 3n4w 3ng8 3np5

(no "Related Entries Specified in the PDB File" available for 2I1Y)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 6)

Exons (10, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (30, 30)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File