2HQS - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF TOLB/PAL COMPLEX

Authors :   I. Grishkovskaya, D. A. Bonsor, C. Kleanthous, E. J. Dodson

Date :   19 Jul 06 (Deposition) - 03 Apr 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.50

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A,H  (1x)
Biol. Unit 2: B,C  (1x)
Biol. Unit 3: D,E  (1x)
Biol. Unit 4: F,G  (1x)

Keywords :   Tolb, Pal, Tol, Transport Protein-Lipoprotein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. A. Bonsor, I. Grishkovskaya, E. J. Dodson, C. Kleanthous
Molecular Mimicry Enables Competitive Recruitment By A Natively Disordered Protein.
J. Am. Chem. Soc. V. 129 4800 2007
PubMed-ID: 17375930 | Reference-DOI: 10.1021/JA070153N

Molecule 1 - PROTEIN TOLB
	Chains	:	A, B, D, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	TOLB
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

Molecule 2 - PEPTIDOGLYCAN-ASSOCIATED LIPOPROTEIN
	Chains	:	H, C, E, G
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	PAL, EXCC
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A							H
Biological Unit 2 (1x)	:		B	C
Biological Unit 3 (1x)	:				D	E
Biological Unit 4 (1x)	:						F	G

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 20)

No.	Name	Count	Type	Full Name
1	ACT	7	Ligand/Ion	ACETATE ION
2	GOL	7	Ligand/Ion	GLYCEROL
3	SO4	6	Ligand/Ion	SULFATE ION

Biological Unit 1 (3, 5)

No.	Name	Count	Type	Full Name
1	ACT	2	Ligand/Ion	ACETATE ION
2	GOL	2	Ligand/Ion	GLYCEROL
3	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 2 (3, 5)

No.	Name	Count	Type	Full Name
1	ACT	2	Ligand/Ion	ACETATE ION
2	GOL	2	Ligand/Ion	GLYCEROL
3	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 3 (3, 3)

No.	Name	Count	Type	Full Name
1	ACT	1	Ligand/Ion	ACETATE ION
2	GOL	1	Ligand/Ion	GLYCEROL
3	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 4 (3, 7)

No.	Name	Count	Type	Full Name
1	ACT	2	Ligand/Ion	ACETATE ION
2	GOL	2	Ligand/Ion	GLYCEROL
3	SO4	3	Ligand/Ion	SULFATE ION

Asymmetric Unit (20, 20)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP H:76 , ALA H:109 , ASP H:110 , ARG H:125 , ARG H:167	BINDING SITE FOR RESIDUE ACT H 5011
02	AC2	SOFTWARE	ARG B:184 , GLN B:193 , ALA B:417 , THR B:418 , ASP B:419 , HOH B:6315	BINDING SITE FOR RESIDUE ACT B 5012
03	AC3	SOFTWARE	ARG F:25 , TYR F:191	BINDING SITE FOR RESIDUE ACT F 5013
04	AC4	SOFTWARE	VAL A:24 , GLN A:193 , ALA A:417 , THR A:418 , ASP A:419 , HOH A:6429 , HOH A:6558 , HOH A:6572	BINDING SITE FOR RESIDUE ACT A 5014
05	AC5	SOFTWARE	LEU C:75 , ASP C:76 , ALA C:109 , ASP C:110 , LEU C:121 , ARG C:125 , ARG C:167	BINDING SITE FOR RESIDUE ACT C 5015
06	AC6	SOFTWARE	LEU E:75 , ALA E:109 , ASP E:110 , ARG E:112 , LEU E:121 , ARG E:125 , ARG E:167 , HOH E:5112	BINDING SITE FOR RESIDUE ACT E 5016
07	AC7	SOFTWARE	LEU G:75 , ASP G:76 , ALA G:109 , ASP G:110 , ARG G:125 , ARG G:167	BINDING SITE FOR RESIDUE ACT G 5017
08	AC8	SOFTWARE	ARG A:25 , TYR A:191 , ASN A:192 , GLN A:193 , HIS A:438 , HOH A:6404	BINDING SITE FOR RESIDUE SO4 A 6002
09	AC9	SOFTWARE	ARG B:25 , TYR B:191 , ASN B:192 , GLN B:193 , HIS B:438 , HOH B:6400	BINDING SITE FOR RESIDUE SO4 B 6004
10	BC1	SOFTWARE	ARG F:25 , TYR F:191 , ASN F:192 , GLN F:193 , HIS F:438 , HOH F:6265 , HOH F:6368	BINDING SITE FOR RESIDUE SO4 F 6005
11	BC2	SOFTWARE	VAL F:24 , ARG F:184 , GLN F:193 , ALA F:417 , THR F:418 , ASP F:419 , HOH F:6204 , HOH F:6464	BINDING SITE FOR RESIDUE SO4 F 6006
12	BC3	SOFTWARE	ARG D:25 , TYR D:191 , ASN D:192 , GLN D:193 , HIS D:438 , HOH D:6513 , HOH D:6557 , HOH D:6586	BINDING SITE FOR RESIDUE SO4 D 6007
13	BC4	SOFTWARE	HOH B:6238 , SER F:30 , GLY F:31 , VAL F:32 , ASP F:33 , HOH F:6099	BINDING SITE FOR RESIDUE SO4 F 6008
14	BC5	SOFTWARE	ALA A:249 , PRO A:250 , GLU A:293 , PRO A:294 , ASP A:337 , GOL A:4663 , HOH A:6051 , HOH A:6062 , HOH A:6063 , HOH A:6070 , GLU H:116	BINDING SITE FOR RESIDUE GOL A 4662
15	BC6	SOFTWARE	ALA A:207 , TRP A:208 , ALA A:251 , TRP A:427 , GOL A:4662 , HOH A:6005 , HOH A:6066 , HOH A:6079 , HOH A:6350	BINDING SITE FOR RESIDUE GOL A 4663
16	BC7	SOFTWARE	ALA B:249 , PRO B:250 , GLU B:293 , PRO B:294 , ASP B:337 , GOL B:4665 , HOH B:6050 , HOH B:6054 , HOH B:6065 , HOH B:6078 , GLU C:116	BINDING SITE FOR RESIDUE GOL B 4664
17	BC8	SOFTWARE	ALA B:207 , TRP B:208 , ALA B:251 , PHE B:252 , GOL B:4664 , HOH B:6058 , HOH B:6149 , HOH B:6445	BINDING SITE FOR RESIDUE GOL B 4665
18	BC9	SOFTWARE	ALA F:249 , PRO F:250 , GLU F:293 , PRO F:294 , GOL F:4667 , HOH F:6023 , HOH F:6030 , HOH F:6040 , HOH F:6046 , HOH F:6081 , HOH F:6587 , GLU G:116	BINDING SITE FOR RESIDUE GOL F 4666
19	CC1	SOFTWARE	ALA F:207 , TRP F:208 , PHE F:252 , GOL F:4666 , HOH F:6032 , HOH F:6053 , HOH F:6105 , HOH F:6106 , HOH F:6587	BINDING SITE FOR RESIDUE GOL F 4667
20	CC2	SOFTWARE	ALA D:249 , PRO D:250 , GLU D:293 , PRO D:294 , HOH D:6040 , HOH D:6043 , HOH D:6047 , HOH D:6073 , HOH D:6078 , HOH D:6114 , GLU E:116	BINDING SITE FOR RESIDUE GOL D 4668

(no "SS Bond" information available for 2HQS)

Asymmetric Unit

No.	Residues
1	Ser B:34	-	Gly B:35

(no "SAP(SNP)/Variant" information available for 2HQS)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	OMPA_1	PS01068	OmpA-like domain.	PAL_ECOLI	105-149	4	C:105-149 E:105-149 G:105-149 H:105-149

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	OMPA_1	PS01068	OmpA-like domain.	PAL_ECOLI	105-149	1	- - - H:105-149

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	OMPA_1	PS01068	OmpA-like domain.	PAL_ECOLI	105-149	1	C:105-149 - - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	OMPA_1	PS01068	OmpA-like domain.	PAL_ECOLI	105-149	1	- E:105-149 - -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	OMPA_1	PS01068	OmpA-like domain.	PAL_ECOLI	105-149	1	- - G:105-149 -

(no "Exon" information available for 2HQS)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:412
 aligned with TOLB_ECOLI | P0A855 from UniProtKB/Swiss-Prot  Length:430

    Alignment length:412
                                                                                                                                                                                                                                                                                                                                                                                                                                                 430    
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       | -  
           TOLB_ECOLI    23 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL----   -
               SCOP domains d2hqsa2 A:24-162 TolB, N-terminal domain                                                                                                   d2hqsa1 A:163-438 TolB, C-terminal domain                                                                                                                                                                                                                                         SCOP domains
               CATH domains 2hqsA01 A:24-165  [code=3.40.50.10070, no name defined]                                                                                       2hqsA02 A:166-438 TolB, C-terminal domain                                                                                                                                                                                                                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeeee...ee........hhhhhhhhhhhhh..eee.hhhhh.....hhhhhhhhhhhh....eeeeeeeee.....eeeeeeeee.......eeeeeeeeehhhhhhhhhhhhhhhhhhhhhh.......eeeeeee.......eeeeeee......eeeeee...eeeeee.....eeeeee......eeeeee.....eeeee.....eeeeee.....eeeeee......eeeeee.....eee.......eeeeee.....eeeeee......eeeeee......ee......eeeeeee.....eeeeeee....eeeeeee.....eee.......eeeee.....eeeeeeee..eeeeeeee.....eee......eeeeeee........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hqs A  24 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYLHHHH 438
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       436  
                                                                                                                                                                                                                                                                                                                                                                                                                                                  432|  
                                                                                                                                                                                                                                                                                                                                                                                                                                                   436

Chain B from PDB  Type:PROTEIN  Length:410
 aligned with TOLB_ECOLI | P0A855 from UniProtKB/Swiss-Prot  Length:430

    Alignment length:410
                                                                                                                                                                                                                                                                                                                                                                                                                                                 430  
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       | -
           TOLB_ECOLI    23 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL--   -
               SCOP domains -----d2hqsb2 B:29-162 TolB, N-terminal domain                                                                                              d2hqsb1 B:163-431 TolB, C-terminal domain                                                                                                                                                                                                                                    -- SCOP domains
               CATH domains 2hqsB01 B:24-165  [code=3.40.50.10070, no name defined]                                                                                       2hqsB02 B:166-438 TolB, C-terminal domain                                                                                                                                                                                                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee.....eeeee...ee........hhhhhhhhhhhhh..eee.hhhhh.....hhhhhhhhhhhh....eeeeeeeee.....eeeeeeeee.......eeeeeeeeehhhhhhhhhhhhhhhhhhhhhh.......eeeeeee.......eeeeeee......eeeeee...eeeeee.....eeeeee......eeeeee.....eeeee.....eeeeee.....eeeeee......eeeeee.....eee.......eeeeee.....eeeeee......eeeeee......ee......eeeeeee.....eeeeeeee..eeeeeeee.....eee.......eeeee.....eeeeeeee..eeeeeeee.....eee......eeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hqs B  24 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYLHH 438
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       438
                                                                                                                                                                                                                                                                                                                                                                                                                                                 431| 
                                                                                                                                                                                                                                                                                                                                                                                                                                                  437

Chain C from PDB  Type:PROTEIN  Length:107
 aligned with PAL_ECOLI | P0A912 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:107
                                                                                                                                   173 
                                    77        87        97       107       117       127       137       147       157       167     | 
            PAL_ECOLI    68 NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY-   -
               SCOP domains d2hqsc_ C: automated matches                                                                                SCOP domains
               CATH domains 2hqsC00 C:68-174 OmpA-like                                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee........hhhhhhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeee...........hhhhhhhhheeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------OMPA_1  PDB: C:105-149 UniProt: 105-149      ------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 2hqs C  68 NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYL 174
                                    77        87        97       107       117       127       137       147       157       167

Chain D from PDB  Type:PROTEIN  Length:410
 aligned with TOLB_ECOLI | P0A855 from UniProtKB/Swiss-Prot  Length:430

    Alignment length:410
                                                                                                                                                                                                                                                                                                                                                                                                                                                 430  
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       | -
           TOLB_ECOLI    23 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL--   -
               SCOP domains -----d2hqsd2 D:29-162 TolB, N-terminal domain                                                                                              d2hqsd1 D:163-431 TolB, C-terminal domain                                                                                                                                                                                                                                    -- SCOP domains
               CATH domains 2hqsD01 D:24-165  [code=3.40.50.10070, no name defined]                                                                                       2hqsD02 D:166-438 TolB, C-terminal domain                                                                                                                                                                                                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeehhhhheeeee...ee........hhhhhhhhhhhhh..eee.hhhhh.....hhhhhhhhhhhh....eeeeeeeee.....eeeeeeeee.......eeeeeeeeehhhhhhhhhhhhhhhhhhhhhh.......eeeeeee.......eeeeeee......eeeeee...eeeeee.....eeeeee......eeeeee.....eeeee.....eeeeee.....eeeeee......eeeeee.....eee.......eeeeee.....eeeeee......eeeeee......ee.......eeeeee.....eeeeeeee..eeeeeeee.....eee.......eeeee.....eeeeeeee..eeeeeeee.....eee......eeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hqs D  24 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYLHH 438
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       438
                                                                                                                                                                                                                                                                                                                                                                                                                                                 431| 
                                                                                                                                                                                                                                                                                                                                                                                                                                                  437

Chain E from PDB  Type:PROTEIN  Length:107
 aligned with PAL_ECOLI | P0A912 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:107
                                                                                                                                   173 
                                    77        87        97       107       117       127       137       147       157       167     | 
            PAL_ECOLI    68 NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY-   -
               SCOP domains d2hqse_ E: automated matches                                                                                SCOP domains
               CATH domains 2hqsE00 E:68-174 OmpA-like                                                                                  CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee........hhhhhhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeee...........hhhhhhhhheeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------OMPA_1  PDB: E:105-149 UniProt: 105-149      ------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 2hqs E  68 NNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYL 174
                                    77        87        97       107       117       127       137       147       157       167

Chain F from PDB  Type:PROTEIN  Length:410
 aligned with TOLB_ECOLI | P0A855 from UniProtKB/Swiss-Prot  Length:430

    Alignment length:410
                                                                                                                                                                                                                                                                                                                                                                                                                                                 430  
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       | -
           TOLB_ECOLI    23 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL--   -
               SCOP domains -----d2hqsf2 F:29-162 TolB, N-terminal domain                                                                                              d2hqsf1 F:163-431 TolB, C-terminal domain                                                                                                                                                                                                                                    -- SCOP domains
               CATH domains 2hqsF01 F:24-165  [code=3.40.50.10070, no name defined]                                                                                       2hqsF02 F:166-438 TolB, C-terminal domain                                                                                                                                                                                                                                    CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeehhhhheeeee...ee........hhhhhhhhhhhhh..eee.hhhhh.....hhhhhhhhhhhh....eeeeeeeee.....eeeeeeeee.......eeeeeeeeehhhhhhhhhhhhhhhhhhhhhh.......eeeeeee.......eeeeeee......eeeeee...eeeeee.....eeeeee......eeeeee.....eeeee.....eeeeee.....eeeeee......eeeeee.....eee.......eeeeee.....eeeeee......eeeeee......ee.......eeeeee.....eeeeeeee..eeeeeeee.....eee.......eeeee.....eeeeeeee..eeeeeeee.....eee......eeeeeee...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hqs F  24 VRIVIDSGVDSGRPIGVVPFQWAGPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYLHH 438
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       438
                                                                                                                                                                                                                                                                                                                                                                                                                                                 431| 
                                                                                                                                                                                                                                                                                                                                                                                                                                                  437

Chain G from PDB  Type:PROTEIN  Length:108
 aligned with PAL_ECOLI | P0A912 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:108
                                                                                                                                    173 
                                    76        86        96       106       116       126       136       146       156       166      | 
            PAL_ECOLI    67 QNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY-   -
               SCOP domains d2hqsg_ G: automated matches                                                                                 SCOP domains
               CATH domains 2hqsG00 G:67-174 OmpA-like                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eee........hhhhhhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeee...........hhhhhhhhheeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------OMPA_1  PDB: G:105-149 UniProt: 105-149      ------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 2hqs G  67 QNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYL 174
                                    76        86        96       106       116       126       136       146       156       166

Chain H from PDB  Type:PROTEIN  Length:108
 aligned with PAL_ECOLI | P0A912 from UniProtKB/Swiss-Prot  Length:173

    Alignment length:108
                                                                                                                                    173 
                                    76        86        96       106       116       126       136       146       156       166      | 
            PAL_ECOLI    67 QNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY-   -
               SCOP domains d2hqsh_ H: automated matches                                                                                 SCOP domains
               CATH domains 2hqsH00 H:67-174 OmpA-like                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eee........hhhhhhhhhhhhhhhhhh....eeeee......hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeee...........hhhhhhhhheeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------OMPA_1  PDB: H:105-149 UniProt: 105-149      ------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 2hqs H  67 QNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVYL 174
                                    76        86        96       106       116       126       136       146       156       166

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: 6-bladed beta-propeller (327)

Superfamily: TolB, C-terminal domain (7)

Family: TolB, C-terminal domain (7)

Protein domain: TolB, C-terminal domain (4)

Escherichia coli [TaxId: 562] (4)

1a	d2hqsa1	A:163-438
1b	d2hqsb1	B:163-431
1c	d2hqsd1	D:163-431
1d	d2hqsf1	F:163-431

Class: Alpha and beta proteins (a+b) (23004)

Fold: Bacillus chorismate mutase-like (324)

Superfamily: OmpA-like (17)

Family: OmpA-like (6)

Protein domain: automated matches (3)

Escherichia coli [TaxId: 562] (2)

2a	d2hqsc_	C:
2b	d2hqse_	E:
2c	d2hqsg_	G:
2d	d2hqsh_	H:

Class: Alpha and beta proteins (a/b) (23833)

Fold: Anticodon-binding domain-like (97)

Superfamily: TolB, N-terminal domain (7)

Family: TolB, N-terminal domain (4)

Protein domain: TolB, N-terminal domain (4)

Escherichia coli [TaxId: 562] (4)

3a	d2hqsa2	A:24-162
3b	d2hqsb2	B:29-162
3c	d2hqsd2	D:29-162
3d	d2hqsf2	F:29-162

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: 60s Ribosomal Protein L30; Chain: A; (235)

Homologous Superfamily: OmpA-like (7)

Escherichia coli. Organism_taxid: 562. (1)

1a	2hqsG00	G:67-174
1b	2hqsH00	H:67-174
1c	2hqsC00	C:68-174
1d	2hqsE00	E:68-174

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: [code=3.40.50.10070, no name defined] (6)

Escherichia coli. Organism_taxid: 562. (1)

2a	2hqsA01	A:24-165
2b	2hqsB01	B:24-165
2c	2hqsD01	D:24-165
2d	2hqsF01	F:24-165

Class: Mainly Beta (13760)

Architecture: 6 Propellor (215)

Topology: Neuraminidase (215)

Homologous Superfamily: TolB, C-terminal domain (42)

Escherichia coli. Organism_taxid: 562. (1)

3a	2hqsA02	A:166-438
3b	2hqsB02	B:166-438
3c	2hqsD02	D:166-438
3d	2hqsF02	F:166-438

(no "Pfam Domain" information available for 2HQS)

Asymmetric Unit(hide GO term definitions)

Chain A,B,D,F (TOLB_ECOLI | P0A855)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0043213	bacteriocin transport	The directed movement of a bacteriocin into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Bacteriocins are a group of antibiotics produced by bacteria and are encoded by a group of naturally occurring plasmids, e.g. Col E1. Bacteriocins are toxic to bacteria closely related to the bacteriocin producing strain.
	GO:0071237	cellular response to bacteriocin	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bacteriocin stimulus. A bacteriocin is a protein substance released by certain bacteria that kills but does not lyse closely related strains of bacteria. Specific bacteriocins attach to specific receptors on cell walls and induce specific metabolic block, e.g. cessation of nucleic acid or protein synthesis of oxidative phosphorylation.
	GO:0017038	protein import	The targeting and directed movement of proteins into a cell or organelle. Not all import involves an initial targeting event.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0032153	cell division site	The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
	GO:0030288	outer membrane-bounded periplasmic space	The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
	GO:0042597	periplasmic space	The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain C,E,G,H (PAL_ECOLI | P0A912)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
cellular component
	GO:0032153	cell division site	The eventual plane of cell division (also known as cell cleavage or cytokinesis) in a dividing cell. In Eukaryotes, the cleavage apparatus, composed of septin structures and the actomyosin contractile ring, forms along this plane, and the mitotic, or meiotic, spindle is aligned perpendicular to the division plane. In bacteria, the cell division site is generally located at mid-cell and is the site at which the cytoskeletal structure, the Z-ring, assembles.
	GO:0009279	cell outer membrane	A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031246	intrinsic component of periplasmic side of cell outer membrane	The component of the cell outer membrane consisting of the gene products that that penetrate the periplasmic side of the cell outer membrane only, either directly or via some covalently attached hydrophobic anchor.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		CC1	[ RasMol ]	+environment [ RasMol ]
		CC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser B:34 - Gly B:35	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2hqs
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PAL_ECOLI \| P0A912
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TOLB_ECOLI \| P0A855
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PAL_ECOLI \| P0A912
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TOLB_ECOLI \| P0A855
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PAL_ECOLI \| P0A912	:	1oap 2w8b
	TOLB_ECOLI \| P0A855	:	1c5k 1crz 2ivz 2w8b 3iax

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 20)

Sites (20, 20)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 12)

CATH Domains (3, 12)

Pfam Domains (0, 0)

Gene Ontology (14, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File