2HEV - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE COMPLEX BETWEEN OX40L AND OX40

Authors :   S. G. Hymowitz, D. M. Compaan

Date :   22 Jun 06 (Deposition) - 29 Aug 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.41

Chains :   Asym. Unit : F,R
Biol. Unit 1: F,R  (3x)

Keywords :   Cytokine, Receptor-Ligand Complex, Tnfsf, Tnfrsf (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. M. Compaan, S. G. Hymowitz
The Crystal Structure Of The Costimulatory Ox40-Ox40L Complex.
Structure V. 14 1321 2006
PubMed-ID: 16905106 | Reference-DOI: 10.1016/J.STR.2006.06.015

Molecule 1 - TUMOR NECROSIS FACTOR LIGAND SUPERFAMILY MEMBER 4
	Chains	:	F
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Strain	:	HI5
	Expression System Taxid	:	7108
	Expression System Vector Type	:	PLASMID
	Fragment	:	EXTRACELLULAR DOMAIN (RESIDUES 51-183)
	Gene	:	TNFSF4, TXGP1
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	OX40 LIGAND, OX40L, GLYCOPROTEIN GP34, TAX TRANSCRIPTIONALLY-ACTIVATED GLYCOPROTEIN 1, CD252 ANTIGEN

Molecule 2 - TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER 4
	Chains	:	R
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Common	:	FALL ARMYWORM
	Expression System Strain	:	HI5
	Expression System Taxid	:	7108
	Expression System Vector Type	:	PLASMID
	Fragment	:	EXTRACELLULAR DOMAIN (RESIDUES 29-170)
	Gene	:	TNFRSF4, TXGP1L
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	OX40L RECEPTOR, ACT35 ANTIGEN, TAX TRANSCRIPTIONALLY- ACTIVATED GLYCOPROTEIN 1 RECEPTOR, CD134 ANTIGEN

		1	2
Asymmetric Unit	:	F	R
Biological Unit 1 (3x)	:	F	R

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	NAG	2	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Biological Unit 1 (1, 6)

No.	Name	Count	Type	Full Name
1	NAG	6	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER F:116 , TYR F:150 , ASN F:152	BINDING SITE FOR RESIDUE NAG F 200
2	AC2	SOFTWARE	ALA R:111 , ASN R:160	BINDING SITE FOR RESIDUE NAG R 200

Asymmetric Unit

No.	Residues
1	F:97	-	F:181
2	R:31	-	R:42
3	R:43	-	R:56
4	R:46	-	R:64
5	R:67	-	R:81
6	R:84	-	R:99
7	R:87	-	R:107
8	R:109	-	R:125
9	R:128	-	R:141
10	R:147	-	R:166

(no "Cis Peptide Bond" information available for 2HEV)

Asymmetric Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_070942	R	65	C	TNR4_HUMAN	Disease (IMD16)	587777075	R	R	65	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_070942	R	65	C	TNR4_HUMAN	Disease (IMD16)	587777075	R	R	65	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (3, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TNFR_NGFR_2	PS50050	TNFR/NGFR family cysteine-rich region domain profile.	TNR4_HUMAN	30-64 66-107	2	R:30-64 R:66-107
2	TNFR_NGFR_1	PS00652	TNFR/NGFR family cysteine-rich region signature.	TNR4_HUMAN	31-64 64-107	2	R:31-64 R:64-107
3	TNF_1	PS00251	TNF family signature.	TNFL4_HUMAN	93-109	1	F:93-109

Biological Unit 1 (3, 15)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TNFR_NGFR_2	PS50050	TNFR/NGFR family cysteine-rich region domain profile.	TNR4_HUMAN	30-64 66-107	6	R:30-64 R:66-107
2	TNFR_NGFR_1	PS00652	TNFR/NGFR family cysteine-rich region signature.	TNR4_HUMAN	31-64 64-107	6	R:31-64 R:64-107
3	TNF_1	PS00251	TNF family signature.	TNFL4_HUMAN	93-109	3	F:93-109

Asymmetric Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000281834	1	ENSE00000814645	chr1:173176452-173176163	290	TNFL4_HUMAN	1-51	51	0	-	-
1.3a	ENST00000281834	3a	ENSE00000789877	chr1:173157708-173157660	49	TNFL4_HUMAN	52-68	17	1	F:58-68	11
1.4a	ENST00000281834	4a	ENSE00001003107	chr1:173156004-173152874	3131	TNFL4_HUMAN	68-183	116	1	F:68-183	116

2.1b	ENST00000379236	1b	ENSE00001832731	chr1:1149512-1149363	150	TNR4_HUMAN	1-49	49	1	R:29-49	21
2.2a	ENST00000379236	2a	ENSE00001333068	chr1:1149165-1149043	123	TNR4_HUMAN	49-90	42	1	R:49-90	42
2.2e	ENST00000379236	2e	ENSE00001333064	chr1:1148473-1148372	102	TNR4_HUMAN	90-124	35	1	R:90-124	35
2.3	ENST00000379236	3	ENSE00001333060	chr1:1148084-1148018	67	TNR4_HUMAN	124-146	23	1	R:124-146	23
2.4b	ENST00000379236	4b	ENSE00001545401	chr1:1147518-1147322	197	TNR4_HUMAN	146-212	67	1	R:146-168	23
2.5a	ENST00000379236	5a	ENSE00001333051	chr1:1147212-1147084	129	TNR4_HUMAN	212-255	44	0	-	-
2.5d	ENST00000379236	5d	ENSE00001915458	chr1:1147005-1146706	300	TNR4_HUMAN	255-277	23	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain F from PDB  Type:PROTEIN  Length:126
 aligned with TNFL4_HUMAN | P23510 from UniProtKB/Swiss-Prot  Length:183

    Alignment length:126
                                    67        77        87        97       107       117       127       137       147       157       167       177      
          TNFL4_HUMAN    58 RIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL 183
               SCOP domains d2hevf1 F:58-183 Tumor necrosis factor ligand superfamily member 4, OX40L                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeeeeeeee...eeeee.........ee..eee....eeeeeeeeeeeeeeeeeeee........eeeeeeeeeeeeeeeee....eeeeeeee.........eeeeeeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) -----------------------------------TNF_1            -------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.3a  ------------------------------------------------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------Exon 1.4a  PDB: F:68-183 UniProt: 68-183                                                                             Transcript 1 (2)
                 2hev F  58 RIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQDNSVIINCDGFYLISLKGYFSQEVDISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL 183
                                    67        77        87        97       107       117       127       137       147       157       167       177

Chain R from PDB  Type:PROTEIN  Length:140
 aligned with TNR4_HUMAN | P43489 from UniProtKB/Swiss-Prot  Length:277

    Alignment length:140
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168
           TNR4_HUMAN    29 LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICED 168
               SCOP domains d2hevr3 R:29-82                                       d2hevr1 R:83-142                                            d2hevr2 R:143-168          SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee..eeee.....eeeee........eeee....ee.........ee....hhhh.eeeee........eeee...eee.........eee....ee........ee.........eeee........eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------C------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -TNFR_NGFR_2  PDB: R:30-64          -TNFR_NGFR_2  PDB: R:66-107 UniProt: 66-107------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --TNFR_NGFR_1  PDB: R:31-64         -------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------------------------TNFR_NGFR_1  PDB: R:64-107 UniProt: 64-107  ------------------------------------------------------------- PROSITE (3)
           Transcript 2 (1) Exon 2.1b            ----------------------------------------Exon 2.2e  PDB: R:90-124           ---------------------Exon 2.4b [INCOMPLETE]  Transcript 2 (1)
           Transcript 2 (2) --------------------Exon 2.2a  PDB: R:49-90 UniProt: 49-90    ---------------------------------Exon 2.3  PDB: R:124-14---------------------- Transcript 2 (2)
                 2hev R  29 LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICED 168
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: TNF-like (100)

Superfamily: TNF-like (100)

Family: TNF-like (82)

Protein domain: Tumor necrosis factor ligand superfamily member 4, OX40L (3)

Human (Homo sapiens) [TaxId: 9606] (1)

d2hevf1

F:58-183

Class: Small proteins (3458)

Fold: TNF receptor-like (25)

Superfamily: TNF receptor-like (25)

Family: TNF receptor-like (16)

Protein domain: Tumor necrosis factor receptor superfamily member 4, OX40L receptor (2)

Human (Homo sapiens) [TaxId: 9606] (2)

2a	d2hevr1	R:83-142
2b	d2hevr2	R:143-168
2c	d2hevr3	R:29-82

(no "CATH Domain" information available for 2HEV)

(no "Pfam Domain" information available for 2HEV)

Asymmetric Unit(hide GO term definitions)

Chain F (TNFL4_HUMAN | P23510)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005164	tumor necrosis factor receptor binding	Interacting selectively and non-covalently with the tumor necrosis factor receptor.
	GO:0032813	tumor necrosis factor receptor superfamily binding	Interacting selectively and non-covalently with any member of the tumor necrosis factor receptor superfamily.
biological process
	GO:0035783	CD4-positive, alpha-beta T cell costimulation	The process of providing, via surface-bound receptor-ligand pairs, a second, antigen-independent, signal in addition to that provided by the T cell receptor to augment CD4-positive, alpha-beta T cell activation.
	GO:0042098	T cell proliferation	The expansion of a T cell population by cell division. Follows T cell activation.
	GO:0035712	T-helper 2 cell activation	The change in morphology and behavior of a T helper 2 cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0002526	acute inflammatory response	Inflammation which comprises a rapid, short-lived, relatively uniform response to acute injury or antigenic challenge and is characterized by accumulations of fluid, plasma proteins, and granulocytic leukocytes. An acute inflammatory response occurs within a matter of minutes or hours, and either resolves within a few days or becomes a chronic inflammatory response.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0035714	cellular response to nitrogen dioxide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nitrogen dioxide (NO2) stimulus.
	GO:0071380	cellular response to prostaglandin E stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a prostagladin E stimulus.
	GO:0071954	chemokine (C-C motif) ligand 11 production	The appearance of chemokine (C-C motif) ligand 11 (CCL11, also known as eotaxin-1) due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
	GO:0008203	cholesterol metabolic process	The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
	GO:0001816	cytokine production	The appearance of a cytokine due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
	GO:0002215	defense response to nematode	A response to protect an organism from a directly detected or perceived external threat from a nematode or nematodes, which results in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0035709	memory T cell activation	The change in morphology and behavior of a memory T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0045626	negative regulation of T-helper 1 cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of T-helper 1 cell differentiation.
	GO:0050710	negative regulation of cytokine secretion	Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of cytokines from a cell.
	GO:0032689	negative regulation of interferon-gamma production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032700	negative regulation of interleukin-17 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
	GO:0045590	negative regulation of regulatory T cell differentiation	Any process that stops, prevents, or reduces the rate of differentiation of regulatory T cells.
	GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0050871	positive regulation of B cell activation	Any process that activates or increases the frequency, rate or extent of B cell activation.
	GO:1900281	positive regulation of CD4-positive, alpha-beta T cell costimulation	Any process that activates or increases the frequency, rate or extent of CD4-positive, alpha-beta T cell costimulation.
	GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	Any process that activates or increases the frequency, rate or extent of CD4-positive, alpha-beta T cell differentiation.
	GO:2000525	positive regulation of T cell costimulation	Any process that activates or increases the frequency, rate or extent of T cell costimulation.
	GO:0002726	positive regulation of T cell cytokine production	Any process that activates or increases the frequency, rate, or extent of T cell cytokine production.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:2000570	positive regulation of T-helper 2 cell activation	Any process that activates or increases the frequency, rate or extent of T-helper 2 cell activation.
	GO:0045630	positive regulation of T-helper 2 cell differentiation	Any process that activates or increases the frequency, rate or extent of T-helper 2 cell differentiation.
	GO:0042104	positive regulation of activated T cell proliferation	Any process that activates or increases the rate or extent of activated T cell proliferation.
	GO:0046641	positive regulation of alpha-beta T cell proliferation	Any process that activates or increases the frequency, rate or extent of alpha-beta T cell proliferation.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0002891	positive regulation of immunoglobulin mediated immune response	Any process that activates or increases the frequency, rate, or extent of an immunoglobulin mediated immune response.
	GO:0051024	positive regulation of immunoglobulin secretion	Any process that activates or increases the frequency, rate or extent of the regulated release of immunoglobulins from a cell.
	GO:0050729	positive regulation of inflammatory response	Any process that activates or increases the frequency, rate or extent of the inflammatory response.
	GO:0032729	positive regulation of interferon-gamma production	Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032733	positive regulation of interleukin-10 production	Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
	GO:0032735	positive regulation of interleukin-12 production	Any process that activates or increases the frequency, rate, or extent of interleukin-12 production.
	GO:0032736	positive regulation of interleukin-13 production	Any process that activates or increases the frequency, rate, or extent of interleukin-13 production.
	GO:0032743	positive regulation of interleukin-2 production	Any process that activates or increases the frequency, rate, or extent of interleukin-2 production.
	GO:0032753	positive regulation of interleukin-4 production	Any process that activates or increases the frequency, rate, or extent of interleukin-4 production.
	GO:2000572	positive regulation of interleukin-4-dependent isotype switching to IgE isotypes	Any process that activates or increases the frequency, rate or extent of interleukin-4-dependent isotype switching to IgE isotypes.
	GO:0032755	positive regulation of interleukin-6 production	Any process that activates or increases the frequency, rate, or extent of interleukin-6 production.
	GO:2000568	positive regulation of memory T cell activation	Any process that activates or increases the frequency, rate or extent of memory T cell activation.
	GO:0043382	positive regulation of memory T cell differentiation	Any process that activates or increases the frequency, rate or extent of memory T cell differentiation.
	GO:0002830	positive regulation of type 2 immune response	Any process that activates or increases the frequency, rate, or extent of a type 2 immune response.
	GO:0002819	regulation of adaptive immune response	Any process that modulates the frequency, rate, or extent of an adaptive immune response.
	GO:0050727	regulation of inflammatory response	Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
	GO:0035713	response to nitrogen dioxide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nitrogen dioxide (NO2) stimulus.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0033209	tumor necrosis factor-mediated signaling pathway	A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain R (TNR4_HUMAN | P43489)

molecular function
	GO:0005031	tumor necrosis factor-activated receptor activity	Combining with tumor necrosis factor, a proinflammatory cytokine produced by monocytes and macrophages, to initiate a change in cell function.
	GO:0001618	virus receptor activity	Combining with a virus component and mediating entry of the virus into the cell.
biological process
	GO:0042098	T cell proliferation	The expansion of a T cell population by cell division. Follows T cell activation.
	GO:0097190	apoptotic signaling pathway	A series of molecular signals which triggers the apoptotic death of a cell. The pathway starts with reception of a signal, and ends when the execution phase of apoptosis is triggered.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0030890	positive regulation of B cell proliferation	Any process that activates or increases the rate or extent of B cell proliferation.
	GO:0043410	positive regulation of MAPK cascade	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
	GO:0051024	positive regulation of immunoglobulin secretion	Any process that activates or increases the frequency, rate or extent of the regulated release of immunoglobulins from a cell.
	GO:0042981	regulation of apoptotic process	Any process that modulates the occurrence or rate of cell death by apoptotic process.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0033209	tumor necrosis factor-mediated signaling pathway	A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hev)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2hev
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TNFL4_HUMAN \| P23510
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TNR4_HUMAN \| P43489
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	615593
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TNFL4_HUMAN \| P23510
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TNR4_HUMAN \| P43489
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	TNR4_HUMAN \| P43489	:	1d0a 2hey

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (10, 10)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (3, 5)

Exons (7, 7)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (73, 85)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File