Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  YEAST ALCOHOL DEHYDROGENASE I, SACCHAROMYCES CEREVISIAE FERMENTATIVE ENZYME
 
Authors :  B. V. Plapp, B. R. Savarimuthu, S. Ramaswamy
Date :  21 Aug 14  (Deposition) - 03 Sep 14  (Release) - 01 Oct 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (2x)
Biol. Unit 2:  C,D  (2x)
Keywords :  Tetramer Of Asymmetric Dimers, Zinc Coordination, Intramolecular Disulfide Bonds, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. B. Raj, S. Ramaswamy, B. V. Plapp
Yeast Alcohol Dehydrogenase Structure And Catalysis.
Biochemistry V. 53 5791 2014
PubMed-ID: 25157460  |  Reference-DOI: 10.1021/BI5006442
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ALCOHOL DEHYDROGENASE 1
    Chains: A, B, C, D
    EC Number: 1.1.1.1
    Engineered: YES
    Expression System: SACCHAROMYCES CEREVISIAE
    Expression System Common: BAKER'S YEAST
    Expression System Plasmid: YEP13
    Expression System Strain: 302-21#2 (ADH1-11, ADH2, LEU2, TRP2)
    Expression System Taxid: 4932
    Expression System Vector Type: PLASMID
    Gene: ADH1, ADC1, YOL086C, O0947
    Organism Common: BAKER'S YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 559292
    Strain: ATCC 204508 / S288C
    Synonym: ALCOHOL DEHYDROGENASE I,YADH-1

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (2x): AB  
Biological Unit 2 (2x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 14)

Asymmetric Unit (3, 14)
No.NameCountTypeFull Name
18ID2Ligand/IonNICOTINAMIDE-8-IODO-ADENINE-DINUCLEOTIDE
2ETF4Ligand/IonTRIFLUOROETHANOL
3ZN8Ligand/IonZINC ION
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
18ID2Ligand/IonNICOTINAMIDE-8-IODO-ADENINE-DINUCLEOTIDE
2ETF4Ligand/IonTRIFLUOROETHANOL
3ZN-1Ligand/IonZINC ION
Biological Unit 2 (2, 6)
No.NameCountTypeFull Name
18ID2Ligand/IonNICOTINAMIDE-8-IODO-ADENINE-DINUCLEOTIDE
2ETF4Ligand/IonTRIFLUOROETHANOL
3ZN-1Ligand/IonZINC ION

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:43 , THR A:45 , HIS A:66 , CYS A:153 , 8ID A:403 , ETF A:404binding site for residue ZN A 401
02AC2SOFTWARECYS A:97 , MET A:98 , CYS A:100 , CYS A:103 , CYS A:111binding site for residue ZN A 402
03AC3SOFTWARECYS A:43 , HIS A:44 , THR A:45 , HIS A:48 , TRP A:54 , CYS A:153 , THR A:157 , GLY A:177 , ALA A:179 , GLY A:180 , GLY A:181 , LEU A:182 , ILE A:200 , ASP A:201 , LYS A:206 , PHE A:221 , VAL A:245 , SER A:246 , SER A:248 , ALA A:251 , VAL A:268 , GLY A:269 , MET A:270 , SER A:293 , TYR A:294 , VAL A:295 , ARG A:340 , ZN A:401 , ETF A:404 , HOH A:515 , HOH A:516 , VAL B:284binding site for residue 8ID A 403
04AC4SOFTWARECYS A:43 , THR A:45 , TRP A:54 , HIS A:66 , TRP A:92 , CYS A:153 , MET A:270 , TYR A:294 , ZN A:401 , 8ID A:403binding site for residue ETF A 404
05AC5SOFTWARECYS B:43 , HIS B:66 , GLU B:67 , CYS B:153 , ETF B:404binding site for residue ZN B 401
06AC6SOFTWARECYS B:97 , CYS B:100 , CYS B:103 , CYS B:111binding site for residue ZN B 402
07AC7SOFTWARETHR B:45 , HIS B:66 , CYS B:153 , MET B:270 , VAL B:295 , ZN B:401binding site for residue ETF B 404
08AC8SOFTWARECYS C:43 , THR C:45 , HIS C:66 , CYS C:153 , 8ID C:403 , ETF C:404binding site for residue ZN C 401
09AC9SOFTWARECYS C:97 , CYS C:100 , CYS C:103 , CYS C:111binding site for residue ZN C 402
10AD1SOFTWARECYS C:43 , HIS C:44 , THR C:45 , HIS C:48 , TRP C:54 , CYS C:153 , THR C:157 , GLY C:177 , ALA C:179 , GLY C:180 , GLY C:181 , LEU C:182 , ILE C:200 , ASP C:201 , LYS C:206 , PHE C:221 , VAL C:245 , SER C:246 , SER C:248 , ALA C:251 , VAL C:268 , GLY C:269 , MET C:270 , SER C:293 , TYR C:294 , VAL C:295 , ARG C:340 , ZN C:401 , ETF C:404 , HOH C:513 , HOH C:514 , VAL D:284binding site for residue 8ID C 403
11AD2SOFTWARECYS C:43 , THR C:45 , TRP C:54 , HIS C:66 , TRP C:92 , CYS C:153 , MET C:270 , TYR C:294 , ZN C:401 , 8ID C:403binding site for residue ETF C 404
12AD3SOFTWARECYS D:43 , HIS D:66 , GLU D:67 , CYS D:153 , ETF D:404binding site for residue ZN D 401
13AD4SOFTWARECYS D:97 , MET D:98 , CYS D:100 , CYS D:103 , CYS D:111binding site for residue ZN D 402
14AD5SOFTWARETHR D:45 , HIS D:66 , CYS D:153 , VAL D:295 , ZN D:401 , HOH D:526binding site for residue ETF D 404

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:277 -B:277
2C:277 -D:277

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:60 -Pro A:61
2Leu B:60 -Pro B:61
3Leu C:60 -Pro C:61
4Leu D:60 -Pro D:61

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4W6Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4W6Z)

(-) Exons   (0, 0)

(no "Exon" information available for 4W6Z)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......eeeeee.......eeeeeeeeee.hhhhhhhhhh.........ee...eeeeeeeee...........eeee..eee....hhhhhh.hhhhh...ee...........eeeee....eee....hhhhhhhhhhhhhhhhhhhhh.......eeeee.....hhhhhhhhhhhhh.eeeeee...hhhhhhhhh...eeee.....hhhhhhhhhh...eeeeee...hhhhhhhhhhheeeeeeeee.......eeeeehhhhhhh..eeee....hhhhhhhhhhhhhh......eeeee..hhhhhhhhhhh.....eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4w6z A   1 SIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK 347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       


Chain B from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......eeeeee.......eeeeeeeeee..hhhhhhhhh.........ee....eeeeeeee...........eeee..eee....hhhhhhhhhhhh...ee...........eeeee....eee....hhhhhhhhhhhhhhhhhhhhhh......eeeee....hhhhhhhhhhhhh..eeeeee...hhhhhhhhh...eeee.....hhhhhhhhhh...eeeeee...hhhhhhhhhhheeeeeeeee.......eeeeehhhhhhh..eeee....hhhhhhhhhhhhhh.......eeee..hhhhhhhhhhh......eeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4w6z B   1 SIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK 347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       


Chain C from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......eeeeee.......eeeeeeeeee.hhhhhhhhhh.........ee....eeeeeeee...........eeee..eee....hhhhhh.hhhhh...ee...........eeeee....eee....hhhhhhhhhhhhhhhhhhhhhh......eeeee.....hhhhhhhhhhhh..eeeeee...hhhhhhhhh...eeee.....hhhhhhhhhh...eeeeee...hhhhhhhhhhheeeeeeeee.......eeeeehhhhhhh..eeee....hhhhhhhhhhhhhh......eeeee..hhhhhhhhhhh.....eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4w6z C   1 SIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK 347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       


Chain D from PDB  Type:PROTEIN  Length:347
                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......eeeeee.......eeeeeeeeeee.hhhhhhhhh.........ee....eeeeeeee...........eeee..eee....hhhhhhhhhhhh...ee...........eeeee....eee........hhhhhhhhhhhhhhhhhh......eeeee...hhhhhhhhhhhhhh..eeeeee...hhhhhhhhh...eeee.....hhhhhhhhhhh..eeeeee...hhhhhhhhhhheeeeeeeee.......eeeeehhhhhhh..eeee....hhhhhhhhhhhhhh.......eeee..hhhhhhhhhhhh.....eeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4w6z D   1 SIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK 347
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4W6Z)

(-) CATH Domains  (0, 0 ; only for superseded entry 2HCY: 2,8)

(no "CATH Domain" information available for 4W6Z, only for superseded entry 2HCY replaced by 4W6Z)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4W6Z)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    8ID  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ETF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:60 - Pro A:61   [ RasMol ]  
    Leu B:60 - Pro B:61   [ RasMol ]  
    Leu C:60 - Pro C:61   [ RasMol ]  
    Leu D:60 - Pro D:61   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4w6z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ADH1_YEAST | P00330
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ADH1_YEAST | P00330
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ADH1_YEAST | P00330: 5env

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4W6Z)