2H63 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN BILIVERDIN REDUCTASE A (CASP TARGET)

Authors :   K. Kavanagh, J. Elkins, E. Ugochukwu, K. Guo, E. Pilka, P. Lukacik, C. Smee, E. Papagrigoriou, G. Bunkoczi, M. Sundstrom, C. Arrowsmith, J. Weigelt, A. Edwards, F. Von Delft, U. Oppermann, Structural Genomics Consortium (Sgc)

Date :   30 May 06 (Deposition) - 04 Jul 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Oxidoreductase, Biliverdin Reductase, Blvra, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Kavanagh, J. Elkins, E. Ugochukwu, K. Guo, E. Pilka, P. Lukacik, C. Smee, E. Papagrigoriou, U. Oppermann
Crystal Structure Of Human Biliverdin Reductase A
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - BILIVERDIN REDUCTASE A
	Chains	:	A, B, C, D
	EC Number	:	1.3.1.24
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNIC28-BSA4
	Expression System Strain	:	BL21(DE3)-R3
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 7-296
	Gene	:	BLVRA
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	BILIVERDIN-IX ALPHA-REDUCTASE, BVR A

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	NAP	4	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	NAP	2	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:15 , VAL A:16 , GLY A:17 , ARG A:18 , ALA A:19 , SER A:44 , ARG A:45 , ARG A:46 , CYS A:74 , SER A:75 , SER A:77 , HIS A:80 , GLU A:97 , TYR A:98 , PHE A:162 , SER D:235	BINDING SITE FOR RESIDUE NAP A 501
2	AC2	SOFTWARE	GLY B:15 , VAL B:16 , GLY B:17 , ARG B:18 , ALA B:19 , SER B:44 , ARG B:45 , ARG B:46 , CYS B:74 , SER B:75 , SER B:77 , HIS B:80 , GLU B:97 , TYR B:98 , PHE B:162 , PHE B:251	BINDING SITE FOR RESIDUE NAP B 501
3	AC3	SOFTWARE	GLY C:15 , VAL C:16 , GLY C:17 , ARG C:18 , ALA C:19 , SER C:44 , ARG C:45 , ARG C:46 , CYS C:74 , SER C:75 , SER C:77 , HIS C:80 , GLU C:97 , TYR C:98 , GLU C:124	BINDING SITE FOR RESIDUE NAP C 501
4	AC4	SOFTWARE	ARG A:7 , SER C:235 , GLY D:15 , VAL D:16 , GLY D:17 , ARG D:18 , ALA D:19 , SER D:44 , ARG D:45 , ARG D:46 , CYS D:74 , SER D:75 , SER D:77 , HIS D:80 , GLU D:97 , TYR D:98 , GLU D:124 , PHE D:162 , HOH D:507	BINDING SITE FOR RESIDUE NAP D 501

(no "SS Bond" information available for 2H63)

Asymmetric Unit

No.	Residues
1	Tyr A:98	-	Pro A:99
2	Tyr B:98	-	Pro B:99
3	Tyr C:98	-	Pro C:99
4	Tyr D:98	-	Pro D:99

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_019231	L	37	V	BIEA_HUMAN	Polymorphism	17245918	A/B/C/D	L	37	V
2	UniProt	VAR_014851	Q	56	R	BIEA_HUMAN	Polymorphism	1050916	A/B/C/D	Q	56	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_019231	L	37	V	BIEA_HUMAN	Polymorphism	17245918	A/C	L	37	V
2	UniProt	VAR_014851	Q	56	R	BIEA_HUMAN	Polymorphism	1050916	A/C	Q	56	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_019231	L	37	V	BIEA_HUMAN	Polymorphism	17245918	B/D	L	37	V
2	UniProt	VAR_014851	Q	56	R	BIEA_HUMAN	Polymorphism	1050916	B/D	Q	56	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2H63)

Asymmetric Unit (6, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000265523	1a	ENSE00001086664	chr7:43798279-43798333	55	BIEA_HUMAN	-	0	0	-	-
1.4b	ENST00000265523	4b	ENSE00001086670	chr7:43810737-43810769	33	BIEA_HUMAN	1-4	4	0	-	-
1.5	ENST00000265523	5	ENSE00000832518	chr7:43827503-43827624	122	BIEA_HUMAN	5-45	41	4	A:6-45 B:7-45 C:7-45 D:6-45	40 39 39 40
1.6a	ENST00000265523	6a	ENSE00000680543	chr7:43830848-43830967	120	BIEA_HUMAN	45-85	41	4	A:45-85 B:45-85 C:45-85 D:45-85	41 41 41 41
1.7b	ENST00000265523	7b	ENSE00000680545	chr7:43832314-43832411	98	BIEA_HUMAN	85-118	34	4	A:85-118 B:85-118 C:85-118 D:85-118	34 34 34 34
1.8b	ENST00000265523	8b	ENSE00000680547	chr7:43840064-43840171	108	BIEA_HUMAN	118-154	37	4	A:118-154 B:118-154 C:118-154 D:118-154	37 37 37 37
1.9b	ENST00000265523	9b	ENSE00000680549	chr7:43843275-43843446	172	BIEA_HUMAN	154-211	58	4	A:154-211 (gaps) B:154-211 (gaps) C:154-211 (gaps) D:154-211 (gaps)	58 58 58 58
1.10a	ENST00000265523	10a	ENSE00000832519	chr7:43846576-43846938	363	BIEA_HUMAN	211-296	86	4	A:211-291 B:211-291 C:211-291 D:211-294	81 81 81 84

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:284
 aligned with BIEA_HUMAN | P53004 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:286
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285      
           BIEA_HUMAN     6 ERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY 291
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2h63A01 A:6-124,A:246-266 NAD(P)-binding Rossmann-like Domain                                                          2h63A02 A:125-245,A:267-291 Dihydrodipicolinate Reductase; domain 2                                                      2h63A01              2h63A02                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee..hhhhhhhhhhhhh..hhhh.eeeeeee..............hhhhhhhh....eeee..hhhhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhh...eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeee.--.eeeeeeeeee....eeeeeeee......eeeeeeee...ee..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------V------------------R------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: A:6-45 UniProt: 5-45     ---------------------------------------Exon 1.7b  PDB: A:85-118          --------------------------------------------------------------------------------------------Exon 1.10a  PDB: A:211-291 UniProt: 211-296 [INCOMPLETE]                          Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.6a  PDB: A:45-85 UniProt: 45-85   --------------------------------Exon 1.8b  PDB: A:118-154            ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) ----------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: A:154-211 (gaps) UniProt: 154-211         -------------------------------------------------------------------------------- Transcript 1 (3)
                 2h63 A   6 MRKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERK--QYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY 291
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185        |- |     205       215       225       235       245       255       265       275       285      
                                                                                                                                                                                                                      194  |                                                                                              
                                                                                                                                                                                                                         197

Chain B from PDB  Type:PROTEIN  Length:279
 aligned with BIEA_HUMAN | P53004 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:285
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286     
           BIEA_HUMAN     7 RKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY 291
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2h63B01 B:7-124,B:246-266 NAD(P)-binding Rossmann-like Domain                                                         2h63B02 B:125-245,B:267-291 Dihydrodipicolinate Reductase; domain 2                                                      2h63B01              2h63B02                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhh...hhh.eeeeeee..............hhhhhhhh....eeee..hhhhhhhhhhhhhhh..eeeee.....hhhhhhhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhh...eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeee.------.eeeeeeee....eeeeeeee......eeeeeeee...ee..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------V------------------R------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: B:7-45 UniProt: 5-45    ---------------------------------------Exon 1.7b  PDB: B:85-118          --------------------------------------------------------------------------------------------Exon 1.10a  PDB: B:211-291 UniProt: 211-296 [INCOMPLETE]                          Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.6a  PDB: B:45-85 UniProt: 45-85   --------------------------------Exon 1.8b  PDB: B:118-154            ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) ---------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: B:154-211 (gaps) UniProt: 154-211         -------------------------------------------------------------------------------- Transcript 1 (3)
                 2h63 B   7 RKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEE------MKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY 291
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186     |   -  |    206       216       226       236       246       256       266       276       286     
                                                                                                                                                                                                                   192    199

Chain C from PDB  Type:PROTEIN  Length:283
 aligned with BIEA_HUMAN | P53004 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:285
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286     
           BIEA_HUMAN     7 RKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY 291
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2h63C01 C:7-124,C:246-266 NAD(P)-binding Rossmann-like Domain                                                         2h63C02 C:125-245,C:267-291 Dihydrodipicolinate Reductase; domain 2                                                      2h63C01              2h63C02                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhh..hhhh.eeeeeee..............hhhhhhhh....eeee..hhhhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhh...eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeee.--.eeeeeeeeee....eeeeeeee......eeeeeeee...ee..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------V------------------R------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: C:7-45 UniProt: 5-45    ---------------------------------------Exon 1.7b  PDB: C:85-118          --------------------------------------------------------------------------------------------Exon 1.10a  PDB: C:211-291 UniProt: 211-296 [INCOMPLETE]                          Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.6a  PDB: C:45-85 UniProt: 45-85   --------------------------------Exon 1.8b  PDB: C:118-154            ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) ---------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: C:154-211 (gaps) UniProt: 154-211         -------------------------------------------------------------------------------- Transcript 1 (3)
                 2h63 C   7 RKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERK--QYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKY 291
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       | -|      206       216       226       236       246       256       266       276       286     
                                                                                                                                                                                                                     194  |                                                                                              
                                                                                                                                                                                                                        197

Chain D from PDB  Type:PROTEIN  Length:285
 aligned with BIEA_HUMAN | P53004 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:289
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285         
           BIEA_HUMAN     6 ERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCS 294
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2h63D01 D:6-124,D:246-266 NAD(P)-binding Rossmann-like Domain                                                          2h63D02 D:125-245,D:267-294 Dihydrodipicolinate Reductase; domain 2                                                      2h63D01              2h63D02 D:125-245,D:267-294  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee..hhhhhhhhhhhhh...hhh.eeeeeee..............hhhhhhhh....eeee..hhhhhhhhhhhhhhhh.eeee......hhhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhh...eeeeeeeeee...hhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeeee..----.eeeeeeeee....eeeeeeee......eeeeeeee...ee..........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------V------------------R---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5  PDB: D:6-45 UniProt: 5-45     ---------------------------------------Exon 1.7b  PDB: D:85-118          --------------------------------------------------------------------------------------------Exon 1.10a  PDB: D:211-294 UniProt: 211-296 [INCOMPLETE]                             Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.6a  PDB: D:45-85 UniProt: 45-85   --------------------------------Exon 1.8b  PDB: D:118-154            -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
           Transcript 1 (3) ----------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.9b  PDB: D:154-211 (gaps) UniProt: 154-211         ----------------------------------------------------------------------------------- Transcript 1 (3)
                 2h63 D   6 MRKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEER----YMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCS 294
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       | -  |    205       215       225       235       245       255       265       275       285         
                                                                                                                                                                                                                     193  198

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2H63)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Dihydrodipicolinate Reductase; domain 2 (182)

Homologous Superfamily: Dihydrodipicolinate Reductase; domain 2 (178)

Human (Homo sapiens) (8)

1a	2h63D02	D:125-245,D:267-294
1b	2h63A02	A:125-245,A:267-291
1c	2h63C02	C:125-245,C:267-291
1d	2h63B02	B:125-245,B:267-291

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Human (Homo sapiens) (188)

2a	2h63A01	A:6-124,A:246-266
2b	2h63D01	D:6-124,D:246-266
2c	2h63B01	B:7-124,B:246-266
2d	2h63C01	C:7-124,C:246-266

(no "Pfam Domain" information available for 2H63)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (BIEA_HUMAN | P53004)

molecular function
	GO:0004074	biliverdin reductase activity	Catalysis of the reaction: bilirubin + NAD(P)+ = biliverdin + NAD(P)H + H+.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0042167	heme catabolic process	The chemical reactions and pathways resulting in the breakdown of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Tyr A:98 - Pro A:99	[ RasMol ]
		Tyr B:98 - Pro B:99	[ RasMol ]
		Tyr C:98 - Pro C:99	[ RasMol ]
		Tyr D:98 - Pro D:99	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2h63
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BIEA_HUMAN \| P53004
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.3.1.24
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BIEA_HUMAN \| P53004
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2H63)

1lc0	STRUCTURE OF BILIVERDIN REDUCTASE AND THE ENZYME-NADH COMPLEX

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (0, 0)

Exons (6, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File