2GW6 - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   NMR STRUCTURE OF THE HUMAN TRNA ENDONUCLEASE SEN15 SUBUNIT

Authors :   J. Song, J. L. Markley, Center For Eukaryotic Structural Genomics (Cesg)

Date :   03 May 06 (Deposition) - 16 May 06 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (20x)

Keywords :   Sen15_human, Trna Endonuclease, Structural Genomics, Psi, Protein Structure Initiative, Center For Eukaryotic Structural Genomics, Cesg, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Song, J. L. Markley
Three-Dimensional Structure Determined For A Subunit Of Human Trna Splicing Endonuclease (Sen15) Reveals A Novel Dimeric Fold.
J. Mol. Biol. V. 366 155 2007
PubMed-ID: 17166513 | Reference-DOI: 10.1016/J.JMB.2006.11.024
(for further references see the PDB file header)

Molecule 1 - TRNA-SPLICING ENDONUCLEASE SUBUNIT SEN15
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PVP13
	Expression System Strain	:	ROSSETTA2(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	TSEN15, C1ORF19, SEN15
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TRNA-INTRON ENDONUCLEASE SEN15, HSSEN15


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2GW6)

(no "Site" information available for 2GW6)

(no "SS Bond" information available for 2GW6)

(no "Cis Peptide Bond" information available for 2GW6)

NMR Structure (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_019458	Q	59	H	SEN15_HUMAN	Polymorphism	1046934	A B	Q	25 325	H
2	UniProt	VAR_077061	W	76	G	SEN15_HUMAN	Disease (PCH2F)	730882223	A B	W	42 342	G
3	UniProt	VAR_077062	H	116	Y	SEN15_HUMAN	Disease (PCH2F)	879253780	A B	H	82 382	Y
4	UniProt	VAR_077063	Y	152	C	SEN15_HUMAN	Disease (PCH2F)	879253779	A B	Y	118 418	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2GW6)

NMR Structure (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000361641	1a	ENSE00000959414	chr1:184020811-184021024	214	SEN15_HUMAN	1-45	45	2	A:1-11 B:301-311	11 11
1.2a	ENST00000361641	2a	ENSE00000822902	chr1:184023488-184023569	82	SEN15_HUMAN	46-73	28	2	A:12-39 B:312-339	28 28
1.3a	ENST00000361641	3a	ENSE00000959415	chr1:184023862-184023997	136	SEN15_HUMAN	73-118	46	2	A:39-84 B:339-384	46 46
1.6b	ENST00000361641	6b	ENSE00000959416	chr1:184041291-184041432	142	SEN15_HUMAN	118-165	48	2	A:84-123 B:384-423	40 40
1.7e	ENST00000361641	7e	ENSE00001639873	chr1:184041961-184043346	1386	SEN15_HUMAN	166-171	6	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:123
 aligned with SEN15_HUMAN | Q8WW01 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:123
                                    44        54        64        74        84        94       104       114       124       134       144       154   
          SEN15_HUMAN    35 PEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTD 157
               SCOP domains -d2gw6a1 A:2-123 tRNA-splicing endonuclease subunit Sen15                                                                   SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhh....hhhhhhhhhhhhhhhhhh....eeeeeee....eeeeeee........eeeeee...eeehhhhhhhhhhhhhhh.......eeeeeee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  Exon 1.2a  PDB: A:12-39     --------------------------------------------Exon 1.6b  PDB: A:84-123 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.3a  PDB: A:39-84 UniProt: 73-118       --------------------------------------- Transcript 1 (2)
                 2gw6 A   1 SEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTD 123
                                    10        20        30        40        50        60        70        80        90       100       110       120

Chain B from PDB  Type:PROTEIN  Length:123
 aligned with SEN15_HUMAN | Q8WW01 from UniProtKB/Swiss-Prot  Length:171

    Alignment length:123
                                    44        54        64        74        84        94       104       114       124       134       144       154   
          SEN15_HUMAN    35 PEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTD 157
               SCOP domains d2gw6b_ B: tRNA-splicing endonuclease subunit Sen15                                                                         SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhh....hhhhhhhhhhhhhhhhhhh...eeeeeee....eeeeeee......eeeeeeee....eehhhhhhhhhhhhhhhh......eeeeeee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------H----------------G---------------------------------------Y-----------------------------------C----- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  Exon 1.2a  PDB: B:312-339   --------------------------------------------Exon 1.6b  PDB: B:384-423 [INCOMPLETE]   Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.3a  PDB: B:339-384 UniProt: 73-118     --------------------------------------- Transcript 1 (2)
                 2gw6 B 301 SEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDLMESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFTLAIVESDSTIVYYKLTD 423
                                   310       320       330       340       350       360       370       380       390       400       410       420

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 2GW6)

(no "Pfam Domain" information available for 2GW6)

NMR Structure(hide GO term definitions)

Chain A,B (SEN15_HUMAN | Q8WW01)

molecular function
	GO:0000213	tRNA-intron endonuclease activity	Catalysis of the endonucleolytic cleavage of pre-tRNA, producing 5'-hydroxyl and 2',3'-cyclic phosphate termini, and specifically removing the intron.
biological process
	GO:0090501	RNA phosphodiester bond hydrolysis	The RNA metabolic process in which the phosphodiester bonds between ribonucleotides are cleaved by hydrolysis.
	GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0008033	tRNA processing	The process in which a pre-tRNA molecule is converted to a mature tRNA, ready for addition of an aminoacyl group.
	GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	Splicing of tRNA substrates via recognition of the folded RNA structure that brings the 5' and 3' splice sites into proximity and cleavage of the RNA at both the 3' and 5' splice sites by an endonucleolytic mechanism, followed by ligation of the exons.
cellular component
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2gw6)

	Sites
(no "Sites" information available for 2gw6)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gw6)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2gw6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SEN15_HUMAN \| Q8WW01
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	617026
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SEN15_HUMAN \| Q8WW01
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2GW6)

(no "Related Entries Specified in the PDB File" available for 2GW6)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

PROSITE Motifs (0, 0)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File