Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  REFINED SOLUTION STRUCTURE OF THE TYR 41--> HIS MUTANT OF THE M13 GENE V PROTEIN. A COMPARISON WITH THE CRYSTAL STRUCTURE
 
Authors :  P. J. M. Folkers, M. Nilges, R. H. A. Folmer, J. J. Prompers, R. N. H. Konings, C. W. Hilbers
Date :  27 Jul 95  (Deposition) - 15 Oct 95  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (30x)
Keywords :  Dna-Binding (Viral) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. J. Prompers, R. H. Folmer, M. Nilges, P. J. Folkers, R. N. Konings, C. W. Hilbers
Refined Solution Structure Of The Tyr41-->His Mutant Of The M13 Gene V Protein. A Comparison With The Crystal Structure.
Eur. J. Biochem. V. 232 506 1995
PubMed-ID: 7556200  |  Reference-DOI: 10.1111/J.1432-1033.1995.506ZZ.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GENE V PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System Plasmid: M13
    Mutation: YES
    Organism Scientific: ENTEROBACTERIA PHAGE M13
    Organism Taxid: 10870

 Structural Features

(-) Chains, Units

  
NMR Structure (30x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2GVA)

(-) Sites  (0, 0)

(no "Site" information available for 2GVA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GVA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GVA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GVA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GVA)

(-) Exons   (0, 0)

(no "Exon" information available for 2GVA)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:87
 aligned with G5P_BPM13 | P69544 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:87
                                    10        20        30        40        50        60        70        80       
             G5P_BPM13    1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87
               SCOP domains d2gvaa_ A: Gene V protein                                                               SCOP domains
               CATH domains 2gvaA00 A:1-87 Nucleic acid-binding proteins                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) ..eeeehhh...eeeeeeee...eeeeeeeeeeeee.....eeeeeee..........-----hhhheeee...eeee...eeeee. Sec.struct. author (1)
     Sec.struct. author (2) ----------------------------------------------------------eeeeee----------------------- Sec.struct. author (2)
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                  2gva A  1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87
                                    10        20        30        40        50        60        70        80       


Chain B from PDB  Type:PROTEIN  Length:87
 aligned with G5P_BPM13 | P69544 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:87
                                    10        20        30        40        50        60        70        80       
             G5P_BPM13    1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87
               SCOP domains d2gvab_ B: Gene V protein                                                               SCOP domains
               CATH domains 2gvaB00 B:1-87 Nucleic acid-binding proteins                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------- Pfam domains
     Sec.struct. author (1) ..eeeehhh...eeeeeeee...eeeeeeeeeeeee.....eeeeeee..........-----hhhheeee...eeee...eeeee. Sec.struct. author (1)
     Sec.struct. author (2) ----------------------------------------------------------eeeeee----------------------- Sec.struct. author (2)
                 SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------- Transcript
                  2gva B  1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87
                                    10        20        30        40        50        60        70        80
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

NMR Structure
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

NMR Structure
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GVA)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A,B   (G5P_BPM13 | P69544)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003697    single-stranded DNA binding    Interacting selectively and non-covalently with single-stranded DNA.
biological process
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0039684    rolling circle single-stranded viral DNA replication    A rolling circle viral DNA replication that begins with a single-stranded viral DNA genome.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2gva)
 
  Sites
(no "Sites" information available for 2gva)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gva)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gva
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  G5P_BPM13 | P69544
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  G5P_BPM13 | P69544
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        G5P_BPM13 | P69544: 1gpv 2gvb

(-) Related Entries Specified in the PDB File

2gvb