|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2GVA) |
Sites (0, 0)| (no "Site" information available for 2GVA) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2GVA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2GVA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2GVA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2GVA) |
Exons (0, 0)| (no "Exon" information available for 2GVA) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:87 aligned with G5P_BPM13 | P69544 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 G5P_BPM13 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 SCOP domains d2gvaa_ A: Gene V protein SCOP domains CATH domains 2gvaA00 A:1-87 Nucleic acid-binding proteins CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2gva A 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:87 aligned with G5P_BPM13 | P69544 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 G5P_BPM13 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 SCOP domains d2gvab_ B: Gene V protein SCOP domains CATH domains 2gvaB00 B:1-87 Nucleic acid-binding proteins CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2gva B 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 2)| NMR Structure |
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2GVA) |
Gene Ontology (4, 4)|
NMR Structure(hide GO term definitions) Chain A,B (G5P_BPM13 | P69544)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|