|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2GVB) |
(no "Site" information available for 2GVB) |
(no "SS Bond" information available for 2GVB) |
(no "Cis Peptide Bond" information available for 2GVB) |
(no "SAP(SNP)/Variant" information available for 2GVB) |
(no "PROSITE Motif" information available for 2GVB) |
(no "Exon" information available for 2GVB) |
NMR StructureChain A from PDB Type:PROTEIN Length:87 aligned with G5P_BPM13 | P69544 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 G5P_BPM13 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 SCOP domains d2gvba_ A: Gene V protein SCOP domains CATH domains 2gvbA00 A:1-87 Nucleic acid-binding proteins CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2gvb A 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 10 20 30 40 50 60 70 80 Chain B from PDB Type:PROTEIN Length:87 aligned with G5P_BPM13 | P69544 from UniProtKB/Swiss-Prot Length:87 Alignment length:87 10 20 30 40 50 60 70 80 G5P_BPM13 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 SCOP domains d2gvbb_ B: Gene V protein SCOP domains CATH domains 2gvbB00 B:1-87 Nucleic acid-binding proteins CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2gvb B 1 MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK 87 10 20 30 40 50 60 70 80
|
NMR Structure |
NMR Structure |
(no "Pfam Domain" information available for 2GVB) |
NMR Structure(hide GO term definitions) Chain A,B (G5P_BPM13 | P69544)
|
|
|
|
|
|
|