|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 6)
Asymmetric/Biological Unit (1, 6)
|
Sites (0, 0)| (no "Site" information available for 2FSW) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2FSW) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2FSW) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2FSW) |
Exons (0, 0)| (no "Exon" information available for 2FSW) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:102 aligned with Q7M7B7_PORGI | Q7M7B7 from UniProtKB/TrEMBL Length:104 Alignment length:102 12 22 32 42 52 62 72 82 92 102 Q7M7B7_PORGI 3 RKISDEECPVRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAIPGISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGMENL 104 SCOP domains d2fswa1 A:3-104 Hypothetical protein PG0823 SCOP domains CATH domains 2fswA00 A:3-104 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------ Transcript 2fsw A 3 RKISDEECPVRKSmQIFAGKWTLLIIFQINRRIIRYGELKRAIPGISEKmLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGmENL 104 12 | 22 32 42 52 62 72 82 92 102 16-MSE 52-MSE 101-MSE Chain B from PDB Type:PROTEIN Length:103 aligned with Q7M7B7_PORGI | Q7M7B7 from UniProtKB/TrEMBL Length:104 Alignment length:103 11 21 31 41 51 61 71 81 91 101 Q7M7B7_PORGI 2 ERKISDEECPVRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAIPGISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGMENL 104 SCOP domains d2fswb_ B: Hypothetical protein PG0823 SCOP domains CATH domains 2fswB00 B:2-104 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 2fsw B 2 ERKISDEECPVRKSmQIFAGKWTLLIIFQINRRIIRYGELKRAIPGISEKmLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGmENL 104 11 | 21 31 41 51| 61 71 81 91 101 16-MSE 52-MSE 101-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2FSW) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2FSW)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|