|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)| Asymmetric/Biological Unit (3, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2FRI) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2FRI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2FRI) |
PROSITE Motifs (1, 1)| Asymmetric/Biological Unit (1, 1) |
Exons (0, 0)| (no "Exon" information available for 2FRI) |
Sequences/Alignments
Asymmetric/Biological UnitChain X from PDB Type:PROTEIN Length:152 aligned with MYG_HORSE | P68082 from UniProtKB/Swiss-Prot Length:154 Alignment length:152 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 MYG_HORSE 2 GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQ 153 SCOP domains d2frix_ X: Myoglobin SCOP domains CATH domains 2friX00 X:1-152 Globins CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -GLOBIN PDB: X:2-147 UniProt: 3-148 ----- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2fri X 1 GLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASEDLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQ 152 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2FRI) |
Gene Ontology (11, 11)|
Asymmetric/Biological Unit(hide GO term definitions) Chain X (MYG_HORSE | P68082)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|