Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF IS200 TRANSPOSASE
 
Authors :  H. H. Lee, J. Y. Yoon, H. S. Kim, J. Y. Kang, K. H. Kim, D. J. Kim, S. W. Suh
Date :  25 Nov 05  (Deposition) - 13 Dec 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Dimer, Stem-Loop Binding, Gene Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. H. Lee, J. Y. Yoon, H. S. Kim, J. Y. Kang, K. H. Kim, D. J. Kim, J. Y. Ha, B. Mikami, H. J. Yoon, S. W. Suh
Crystal Structure Of A Metal Ion-Bound Is200 Transposase
J. Biol. Chem. V. 281 4261 2006
PubMed-ID: 16340015  |  Reference-DOI: 10.1074/JBC.M511567200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRANSPOSASE, PUTATIVE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-21A(+)
    Expression System Strain: ROSETTA2(DE3)PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: SULFOLOBUS SOLFATARICUS
    Organism Taxid: 2287
    Synonym: IS200 TRANSPOSASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2F5G)

(-) Sites  (0, 0)

(no "Site" information available for 2F5G)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2F5G)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2F5G)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2F5G)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2F5G)

(-) Exons   (0, 0)

(no "Exon" information available for 2F5G)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:130
 aligned with Q97Y68_SULSO | Q97Y68 from UniProtKB/TrEMBL  Length:133

    Alignment length:130
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
         Q97Y68_SULSO     2 ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE 131
               SCOP domains d2f5ga_ A: automated matches                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeee.eeeeee.........hhhhhhhhhhhhhhhhhhhh.eeeeeeee..eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhh........eeeeee...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2f5g A   2 ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE 131
                                    11        21        31        41        51        61        71        81        91       101       111       121       131


Chain B from PDB  Type:PROTEIN  Length:130
 aligned with Q97Y68_SULSO | Q97Y68 from UniProtKB/TrEMBL  Length:133

    Alignment length:130
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
         Q97Y68_SULSO     2 ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE 131
               SCOP domains d2f5gb_ B: automated matches                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeee.eeeeee.........hhhhhhhhhhhhhhhhhhh..eeeeeeee..eeeeeee.....hhhhhhhhhhhhhhhhhhhhh............eeeeee...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2f5g B   2 ELKSTRHTKYLCNYHFVWIPKHRRNTLVNEIAEYTKEVLKSIAEELGCEIIALEVMPDHIHLFVNCPPRYAPSYLANYFKGKSARLILKKFPQLNKGKLWTRSYFVATAGNVSSEVIKKYIEEQWRKEGE 131
                                    11        21        31        41        51        61        71        81        91       101       111       121       131
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2F5G)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2F5G)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q97Y68_SULSO | Q97Y68)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0004803    transposase activity    Catalysis of the transposition of transposable elements or transposons. Transposases are involved in recombination required for transposition and are site-specific for the transposon/transposable element.
biological process
    GO:0006313    transposition, DNA-mediated    Any process involved in a type of transpositional recombination which occurs via a DNA intermediate.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2f5g)
 
  Sites
(no "Sites" information available for 2f5g)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2f5g)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2f5g
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q97Y68_SULSO | Q97Y68
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q97Y68_SULSO | Q97Y68
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q97Y68_SULSO | Q97Y68: 2f4f

(-) Related Entries Specified in the PDB File

2f4f