|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric/Biological Unit (1, 2)
|
Sites (0, 0)| (no "Site" information available for 2F3L) |
SS Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2F3L) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2F3L) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2F3L) |
Exons (0, 0)| (no "Exon" information available for 2F3L) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:132 aligned with RFR32_CYAA5 | B1WVN5 from UniProtKB/Swiss-Prot Length:179 Alignment length:132 56 66 76 86 96 106 116 126 136 146 156 166 176 RFR32_CYAA5 47 ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAIMMRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLGC 178 SCOP domains d2f3la1 A:7-138 Lumenal RFR-domain protein SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript 2f3l A 7 ASYEDVKLIGEDFSGKSLTYAQFTNADLTDSNFSEADLRGAVFNGSALIGADLHGADLTNGLAYLTSFKGADLTNAVLTEAImmRTKFDDAKITGADFSLAVLDVYEVDKLCDRADGVNPKTGVSTRESLRC 138 16 26 36 46 56 66 76 86 || 96 106 116 126 136 89-MSE 90-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2F3L) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2F3L) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (RFR32_CYAA5 | B1WVN5)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|