|   | 
| 
 | 
 | 
| 
 
 |  | 
 
 Description
Description| 
 
 | 
 
 Compounds
Compounds| 
 | ||||||||||||||||||||||||||||||||||||||||||||
 
 Chains, Units
Chains, Units| 
 Summary Information (see also Sequences/Alignments below) | 
 
 Ligands, Modified Residues, Ions  (1, 1)
Ligands, Modified Residues, Ions  (1, 1)| Asymmetric Unit (1, 1) 
 
 
 | 
 
 Sites  (1, 1)
Sites  (1, 1)| Asymmetric Unit (1, 1) 
 | 
 
 SS Bonds  (0, 0)
SS Bonds  (0, 0)| (no "SS Bond" information available for 2ESH) | 
 
 Cis Peptide Bonds  (2, 2)
Cis Peptide Bonds  (2, 2)| Asymmetric Unit 
 | ||||||||||||
 
 SAPs(SNPs)/Variants  (0, 0)
SAPs(SNPs)/Variants  (0, 0)| (no "SAP(SNP)/Variant" information available for 2ESH) | 
 
 PROSITE Motifs  (0, 0)
PROSITE Motifs  (0, 0)| (no "PROSITE Motif" information available for 2ESH) | 
 
 Exons   (0, 0)
Exons   (0, 0)| (no "Exon" information available for 2ESH) | 
 
 Sequences/Alignments
Sequences/Alignments| Asymmetric Unit Chain A from PDB Type:PROTEIN Length:114 aligned with Q9X035_THEMA | Q9X035 from UniProtKB/TrEMBL Length:118 Alignment length:114 13 23 33 43 53 63 73 83 93 103 113 Q9X035_THEMA 4 RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE 117 SCOP domains d2esha1 A:4-117 Hypothetical protein TM0937 SCOP domains CATH domains 2eshA00 A:4-117 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------ Transcript 2esh A 4 RGGRGFRGWWLASTILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDTTVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRVLQE 117 13 23 33 43 53 63 73 83 93 103 113 
 | ||||||||||||||||||||
 
 SCOP Domains  (1, 1)
SCOP Domains  (1, 1)| Asymmetric Unit | 
 
 CATH Domains  (1, 1)
CATH Domains  (1, 1)| Asymmetric Unit 
 | 
 
 Pfam Domains  (0, 0)
Pfam Domains  (0, 0)| (no "Pfam Domain" information available for 2ESH) | 
 
 Gene Ontology  (0, 0)
Gene Ontology  (0, 0)| Asymmetric Unit(hide GO term definitions) 
    (no "Gene Ontology" information available for 2ESH)
 | 
 
 Interactive Views
Interactive Views| 
 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 
 Still Images
Still Images| 
 | ||||||||||||||||
 
 Databases
Databases| 
 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 
 Analysis Tools
Analysis Tools| 
 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
 
 Entries Sharing at Least One Protein Chain (UniProt ID)
Entries Sharing at Least One Protein Chain (UniProt ID) 
 Related Entries Specified in the PDB File
Related Entries Specified in the PDB File| 
 | 
 |