2EP6 - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE SECOND C2 DOMAIN FROM HUMAN MCTP2 PROTEIN

Authors :   T. Nagashima, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   29 Mar 07 (Deposition) - 02 Oct 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Beta Sandwich, Ca2+ Binding, Membrane Binding, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Nagashima, F. Hayashi, S. Yokoyama
Solution Structure Of The Second C2 Domain From Human Mctp2 Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - MCTP2 PROTEIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P060327-19
	Expression System Vector Type	:	PLASMID
	Fragment	:	C2 DOMAIN
	Gene	:	MCTP2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2EP6)

Sites (0, 0)

(no "Site" information available for 2EP6)

SS Bonds (0, 0)

(no "SS Bond" information available for 2EP6)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2EP6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

(no "SAP(SNP)/Variant" information available for 2EP6)

PROSITE Motifs (1, 1)

NMR Structure (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C2	PS50004	C2 domain profile.	MCTP2_HUMAN	196-276 511-591 358-436	1	- A:99-179 -

Exons (5, 5)

NMR Structure (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000357742	1	ENSE00001419592	chr15:94774951-94775234	284	MCTP2_HUMAN	-	0	0	-	-
1.2a	ENST00000357742	2a	ENSE00002186293	chr15:94841430-94841959	530	MCTP2_HUMAN	1-155	155	0	-	-
1.3	ENST00000357742	3	ENSE00001668096	chr15:94857511-94857573	63	MCTP2_HUMAN	156-176	21	0	-	-
1.5	ENST00000357742	5	ENSE00001712368	chr15:94858758-94858866	109	MCTP2_HUMAN	177-213	37	0	-	-
1.6	ENST00000357742	6	ENSE00001592080	chr15:94882519-94882661	143	MCTP2_HUMAN	213-260	48	0	-	-
1.7	ENST00000357742	7	ENSE00001749234	chr15:94883428-94883504	77	MCTP2_HUMAN	261-286	26	0	-	-
1.8	ENST00000357742	8	ENSE00001658264	chr15:94884042-94884153	112	MCTP2_HUMAN	286-323	38	0	-	-
1.9	ENST00000357742	9	ENSE00001794737	chr15:94888358-94888393	36	MCTP2_HUMAN	324-335	12	0	-	-
1.10	ENST00000357742	10	ENSE00001621146	chr15:94899366-94899530	165	MCTP2_HUMAN	336-390	55	0	-	-
1.11	ENST00000357742	11	ENSE00001684063	chr15:94901711-94901841	131	MCTP2_HUMAN	391-434	44	0	-	-
1.12	ENST00000357742	12	ENSE00000943872	chr15:94910834-94911020	187	MCTP2_HUMAN	434-496	63	1	A:85-87	3
1.13	ENST00000357742	13	ENSE00001302905	chr15:94913316-94913409	94	MCTP2_HUMAN	497-528	32	1	A:88-116	29
1.14	ENST00000357742	14	ENSE00000943874	chr15:94927251-94927353	103	MCTP2_HUMAN	528-562	35	1	A:116-150	35
1.15	ENST00000357742	15	ENSE00000943875	chr15:94928652-94928754	103	MCTP2_HUMAN	562-596	35	1	A:150-184	35
1.16	ENST00000357742	16	ENSE00000943876	chr15:94942190-94942291	102	MCTP2_HUMAN	597-630	34	1	A:185-217	33
1.17	ENST00000357742	17	ENSE00000943877	chr15:94943150-94943224	75	MCTP2_HUMAN	631-655	25	0	-	-
1.18	ENST00000357742	18	ENSE00000943878	chr15:94945129-94945248	120	MCTP2_HUMAN	656-695	40	0	-	-
1.20	ENST00000357742	20	ENSE00000943879	chr15:94983405-94983527	123	MCTP2_HUMAN	696-736	41	0	-	-
1.21	ENST00000357742	21	ENSE00000995527	chr15:94986148-94986189	42	MCTP2_HUMAN	737-750	14	0	-	-
1.22	ENST00000357742	22	ENSE00000995532	chr15:95001366-95001475	110	MCTP2_HUMAN	751-787	37	0	-	-
1.23	ENST00000357742	23	ENSE00000995528	chr15:95013562-95013671	110	MCTP2_HUMAN	787-824	38	0	-	-
1.24	ENST00000357742	24	ENSE00000995531	chr15:95019925-95020022	98	MCTP2_HUMAN	824-856	33	0	-	-
1.25	ENST00000357742	25	ENSE00001423108	chr15:95022195-95023632	1438	MCTP2_HUMAN	857-878	22	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:133
 aligned with MCTP2_HUMAN | Q6DN12 from UniProtKB/Swiss-Prot  Length:878

    Alignment length:158
                                   481       491       501       511       521       531       541       551       561       571       581       591       601       611       621        
          MCTP2_HUMAN   472 GVSVSDLCVCPLADLSERKQITQRYCLQNSLKDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYN 629
               SCOP domains --------------------------------d2ep6a1 A:92-217 Multiple C2 and transmembrane domain-containing protein 2, MCTP2                                              SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...-------------------------.........eeeeeeeeeee............eeeeeee..eeee.............eeeeeee.....eeeeeeeeee..eeeee....eee.hhh.....ee..............eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------C2  PDB: A:99-179 UniProt: 511-591                                               -------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: A:85-87  Exon 1.13  PDB: A:88-116        ---------------------------------Exon 1.15  PDB: A:150-184          Exon 1.16  PDB: A:185-217         Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------Exon 1.14  PDB: A:116-150          ------------------------------------------------------------------- Transcript 1 (2)
                 2ep6 A  85 GSS-------------------------GSSGDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYN 217
                              |      -         -        89        99       109       119       129       139       149       159       169       179       189       199       209        
                             87                        88

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: C2 domain-like (198)

Superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) (148)

Family: PLC-like (P variant) (81)

Protein domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2 (1)

Human (Homo sapiens) [TaxId: 9606] (1)

d2ep6a1

A:92-217

CATH Domains (0, 0)

(no "CATH Domain" information available for 2EP6)

Pfam Domains (0, 0)

(no "Pfam Domain" information available for 2EP6)

Gene Ontology (9, 9)

NMR Structure(hide GO term definitions)

Chain A (MCTP2_HUMAN | Q6DN12)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0005544	calcium-dependent phospholipid binding	Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester, in the presence of calcium.
biological process
	GO:0019722	calcium-mediated signaling	Any intracellular signal transduction in which the signal is passed on within the cell via calcium ions.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ep6)

	Sites
(no "Sites" information available for 2ep6)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2ep6)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2ep6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MCTP2_HUMAN \| Q6DN12
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MCTP2_HUMAN \| Q6DN12
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)