Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF T.TH.HB8 BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE COMPLEXED WITH GABAPENTIN
 
Authors :  M. Goto
Date :  14 Mar 07  (Deposition) - 18 Mar 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (2x)
Keywords :  Plp-Dependent Enzyme, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Goto
Crystal Structure Of T. Th. Hb8 Branched-Chain Amino Acid Aminotransferase Complexed With Gabapentin
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE
    ChainsA, B, C
    EC Number2.6.1.42
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET11A
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymILVE

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (2x)ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 11)

Asymmetric Unit (3, 11)
No.NameCountTypeFull Name
1GBN3Ligand/Ion[1-(AMINOMETHYL)CYCLOHEXYL]ACETIC ACID
2MPD5Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
3PLP3Ligand/IonPYRIDOXAL-5'-PHOSPHATE
Biological Unit 1 (3, 22)
No.NameCountTypeFull Name
1GBN6Ligand/Ion[1-(AMINOMETHYL)CYCLOHEXYL]ACETIC ACID
2MPD10Ligand/Ion(4S)-2-METHYL-2,4-PENTANEDIOL
3PLP6Ligand/IonPYRIDOXAL-5'-PHOSPHATE

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG A:59 , ARG A:148 , LYS A:159 , TYR A:164 , GLU A:193 , GLY A:196 , LEU A:216 , GLY A:218 , ILE A:219 , THR A:220 , GLY A:255 , THR A:256 , HOH A:2443 , HOH A:2446BINDING SITE FOR RESIDUE PLP A 413
02AC2SOFTWAREARG B:59 , LYS B:159 , TYR B:164 , GLU B:193 , GLY B:196 , LEU B:216 , GLY B:218 , ILE B:219 , THR B:220 , GLY B:255 , THR B:256 , HOH B:928 , HOH B:958BINDING SITE FOR RESIDUE PLP B 913
03AC3SOFTWAREARG C:59 , ARG C:148 , LYS C:159 , TYR C:164 , GLU C:193 , GLY C:196 , LEU C:216 , GLY C:218 , ILE C:219 , THR C:220 , GLY C:255 , THR C:256 , HOH C:1425 , HOH C:1447BINDING SITE FOR RESIDUE PLP C 1413
04AC4SOFTWAREARG A:97 , GLY A:196 , GLU A:197 , GLY A:255 , THR A:256 , ALA A:257 , ALA A:258 , HOH A:2539 , HOH A:2554 , TYR C:31BINDING SITE FOR RESIDUE GBN A 2414
05AC5SOFTWAREARG B:97 , GLY B:196 , GLU B:197 , GLY B:255 , THR B:256 , ALA B:257 , ALA B:258 , HOH B:983 , HOH B:984 , HOH B:1091BINDING SITE FOR RESIDUE GBN B 914
06AC6SOFTWARETYR A:31 , ARG C:97 , GLY C:196 , GLU C:197 , GLY C:255 , THR C:256 , ALA C:257 , ALA C:258 , HOH C:1457 , HOH C:1469 , HOH C:1572BINDING SITE FOR RESIDUE GBN C 1414
07AC7SOFTWAREASP A:230 , GLU A:297 , HOH A:2472 , HOH A:2502 , GLU C:289 , ARG C:294 , ARG C:295BINDING SITE FOR RESIDUE MPD A 2416
08AC8SOFTWAREARG A:52 , GLU A:55 , GLU A:217 , ILE A:219 , ASP A:222 , HOH A:2524 , HOH A:2532 , ARG C:203 , ASP C:204BINDING SITE FOR RESIDUE MPD A 1417
09AC9SOFTWARELEU B:107 , TRP B:124 , TRP B:126BINDING SITE FOR RESIDUE MPD B 915
10BC1SOFTWAREARG A:203 , ASP A:204 , ARG B:52 , GLU B:55 , GLU B:217 , GLY B:218 , ASP B:222 , HOH B:967BINDING SITE FOR RESIDUE MPD B 917
11BC2SOFTWAREARG B:203 , ASP B:204 , ARG C:52 , GLU C:55 , GLU C:217 , ASP C:222 , HOH C:1521 , HOH C:1569BINDING SITE FOR RESIDUE MPD C 1416

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2EJ3)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Asn A:115 -Pro A:116
2Asn B:115 -Pro B:116
3Asn C:115 -Pro C:116

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2EJ3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2EJ3)

(-) Exons   (0, 0)

(no "Exon" information available for 2EJ3)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:297
 aligned with Q5SM19_THET8 | Q5SM19 from UniProtKB/TrEMBL  Length:308

    Alignment length:305
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301     
         Q5SM19_THET8     2 QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWGAYLGEEAVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN 306
               SCOP domains d2ej3a_ A: automated matches                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains ---2ej3A01 A:5-126  [code=3.30.470.10, no name defined]                                                                      --------2ej3A02 A:135-294 D-amino Acid Aminotransferase, subunit A, domain 2                                                                                            ------------ CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eeehhhhh.....hhhhhhh.eee..eeeeee..eeeeehhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh....eeeeeeee.........hhhhh..eeeeeeee.--------....eeeee................hhhhhhhhhhhhhhhhhh...eeeee.....eeee...eeeeee..eeeee.......hhhhhhhhhhhhhh...eeee..hhhhhhh..eeeeee...eeeeeeee..ee......hhhhhhhhhhhhhhhh..hhhhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ej3 A   2 QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEW--------VRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN 306
                                    11        21        31        41        51        61        71        81        91       101       111       121    |    -   |   141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301     
                                                                                                                                                      126      135                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:304
 aligned with Q5SM19_THET8 | Q5SM19 from UniProtKB/TrEMBL  Length:308

    Alignment length:304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302    
         Q5SM19_THET8     3 IKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWGAYLGEEAVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN 306
               SCOP domains d2ej3b_ B: automated matches                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains --2ej3B01 B:5-130  [code=3.30.470.10, no name defined]                                                                          2ej3B02 B:131-294 D-amino Acid Aminotransferase, subunit A, domain 2                                                                                                ------------ CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee..eeee.hhh.....hhhhhhh.eee..eeeeee..eeeeehhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh....eeeeeeee.........hhhhh..eeeeeee......hhhhhhhheeeee................hhhhhhhhhhhhhhhhhhh..eeeee.....eeee...eeeeee..eeeee.......hhhhhhhhhhhhhh..eeeee..hhhhhhh..eeeeee...eeeeeeee..ee......hhhhhhhhhhhhhhhh..hhhhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ej3 B   3 IKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWGAYLGEEAVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN 306
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302    

Chain C from PDB  Type:PROTEIN  Length:294
 aligned with Q5SM19_THET8 | Q5SM19 from UniProtKB/TrEMBL  Length:308

    Alignment length:304
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302    
         Q5SM19_THET8     3 IKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEWGAYLGEEAVRKGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN 306
               SCOP domains d2ej3c_ C: automated matches                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains --2ej3C01 C:5-126  [code=3.30.470.10, no name defined]                                                                      ----------2ej3C02 C:137-294 D-amino Acid Aminotransferase, subunit A, domain 2                                                                                          ------------ CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee..eeehhhhh.....hhhhhhh.eee..eeeeee..eeeeehhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh.....eeeeeeee.........hhhhh..eeeeeeee.----------..eeeee................hhhhhhhhhhhhhhhhhh...eeeee.....eeee...eeeeee..eeeee.......hhhhhhhhhhhhhhh.eeeee..hhhhhhh..eeeeee...eeeeeeee..ee......hhhhhhhhhhhhhhhh..hhhhhh.eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ej3 C   3 IKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIFRLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAWMGAKALGVNPLPNNPAEVMVAAWEW----------KGARLITSSWARFPANVMPGKAKVGGNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALEHSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVTPVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN 306
                                    12        22        32        42        52        62        72        82        92       102       112       122   |     -    |  142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302    
                                                                                                                                                     126        137                                                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2EJ3)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (Q5SM19_THET8 | Q5SM19)
molecular function
    GO:0004084    branched-chain-amino-acid transaminase activity    Catalysis of the reaction: a branched-chain amino acid + 2-oxoglutarate = L-glutamate + a 2-oxocarboxylate derived from the branched-chain amino acid.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0008483    transaminase activity    Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0009081    branched-chain amino acid metabolic process    The chemical reactions and pathways involving amino acids containing a branched carbon skeleton, comprising isoleucine, leucine and valine.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GBN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MPD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:115 - Pro A:116   [ RasMol ]  
    Asn B:115 - Pro B:116   [ RasMol ]  
    Asn C:115 - Pro C:116   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ej3
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5SM19_THET8 | Q5SM19
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.6.1.42
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q5SM19_THET8 | Q5SM19
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q5SM19_THET8 | Q5SM191wrv 2eiy 2ej0 2ej2

(-) Related Entries Specified in the PDB File

2eiy 2ej0 2ej2