|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2EHE) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EHE) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EHE) |
PROSITE Motifs (2, 4)
NMR Structure (2, 4)
|
||||||||||||||||||||||||||||||||
Exons (3, 3)
NMR Structure (3, 3)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:82 aligned with FHL3_HUMAN | Q13643 from UniProtKB/Swiss-Prot Length:280 Alignment length:131 25 35 45 55 65 75 85 95 105 115 125 135 145 FHL3_HUMAN 16 GRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKG 146 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ------------------------LIM_DOMAIN_1 PDB: A:18-53 -------------------------LIM_DOMAIN_1 PDB: A:77-78 ---------- PROSITE (1) PROSITE (2) ----------------------LIM_DOMAIN_2 PDB: A:16-76 UniProt: 38-98 LIM_DOMAIN_2 PDB: A:77-82 UniProt: 99-160 PROSITE (2) Transcript 1 (1) Exon 1.2 PDB: A:1-30 (gaps) Exon 1.3a PDB: A:31-76 UniProt: 53-111 [INCOMPLETE] ----------------------------------- Transcript 1 (1) Transcript 1 (2) -----------------------------------------------------------------------------------------------Exon 1.4 PDB: A:77-82 (gaps) Transcript 1 (2) 2ehe A 1 GS---SGSSG----PCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFS-------------------------------SG-----------PSSG 82 | | 7 | 13 23 33 43 53 63 73 | - - - || - |81 2 3 7 8 76 77| 79 78
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2EHE) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EHE) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EHE) |
Gene Ontology (10, 10)|
NMR Structure(hide GO term definitions) Chain A (FHL3_HUMAN | Q13643)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|