|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2EBB) |
Sites (0, 0)| (no "Site" information available for 2EBB) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2EBB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2EBB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2EBB) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2EBB) |
Exons (0, 0)| (no "Exon" information available for 2EBB) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:96 aligned with Q5KYG7_GEOKA | Q5KYG7 from UniProtKB/TrEMBL Length:101 Alignment length:96 10 20 30 40 50 60 70 80 90 Q5KYG7_GEOKA 1 MRLTEEEVQALLEKADGWKLADERWIVKKYRFQDYLQGIEFVRRIAAISENANHHPFISIDYKLITVKLSSWRAKGLTKLDFDLAKQYDEVYNQMK 96 SCOP domains d2ebba_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 2ebb A 3 MRLTEEEVQALLEKADGWKLADERWIVKKYRFQDYLQGIEFVRRIAAISENANHHPFISIDYKLITVKLSSWRAKGLTKLDFDLAKQYDEVYNQMK 98 12 22 32 42 52 62 72 82 92
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2EBB) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2EBB) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (Q5KYG7_GEOKA | Q5KYG7)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|