2E72 - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - model 1, sites (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE ZINC FINGER DOMAIN OF HUMAN KIAA0461

Authors :   W. Tanabe, S. Suzuki, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   05 Jan 07 (Deposition) - 10 Jul 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Zinc Finger Domain, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. Tanabe, S. Suzuki, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama
Solution Structure Of The Zinc Finger Domain Of Human Kiaa0461
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - POGO TRANSPOSABLE ELEMENT WITH ZNF DOMAIN
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P050912-02
	Expression System Vector Type	:	PLASMID
	Fragment	:	ZINC FINGER DOMAIN
	Gene	:	POGZ, KIAA0461
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

NMR Structure (1, 1)

No.	Name	Count	Type	Full Name
1	ZN	1	Ligand/Ion	ZINC ION

NMR Structure (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS A:377 , CYS A:380 , HIS A:393 , CYS A:397	BINDING SITE FOR RESIDUE ZN A 201

(no "SS Bond" information available for 2E72)

NMR Structure

No.	Model	Residues
1	1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20	Gly A:407	-	Pro A:408

(no "SAP(SNP)/Variant" information available for 2E72)

(no "PROSITE Motif" information available for 2E72)

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000271715	1a	ENSE00001430653	chr1:151431941-151431628	314	POGZ_HUMAN	-	0	0	-	-
1.5b	ENST00000271715	5b	ENSE00002185989	chr1:151414681-151414557	125	POGZ_HUMAN	1-42	42	0	-	-
1.6a	ENST00000271715	6a	ENSE00002093571	chr1:151413562-151413404	159	POGZ_HUMAN	42-95	54	0	-	-
1.7d	ENST00000271715	7d	ENSE00002139587	chr1:151403317-151403142	176	POGZ_HUMAN	95-153	59	0	-	-
1.8a	ENST00000271715	8a	ENSE00002103645	chr1:151402187-151402079	109	POGZ_HUMAN	154-190	37	0	-	-
1.9	ENST00000271715	9	ENSE00002130855	chr1:151400889-151400599	291	POGZ_HUMAN	190-287	98	0	-	-
1.10a	ENST00000271715	10a	ENSE00000960078	chr1:151400517-151400299	219	POGZ_HUMAN	287-360	74	1	A:363-369	7
1.11b	ENST00000271715	11b	ENSE00000960079	chr1:151397537-151397431	107	POGZ_HUMAN	360-395	36	1	A:370-395	26
1.12c	ENST00000271715	12c	ENSE00001617156	chr1:151396762-151396425	338	POGZ_HUMAN	396-508	113	1	A:396-411 (gaps)	44
1.13c	ENST00000271715	13c	ENSE00000960081	chr1:151396027-151395873	155	POGZ_HUMAN	508-560	53	0	-	-
1.14	ENST00000271715	14	ENSE00001045225	chr1:151384872-151384772	101	POGZ_HUMAN	560-593	34	0	-	-
1.15b	ENST00000271715	15b	ENSE00001253736	chr1:151384247-151384101	147	POGZ_HUMAN	594-642	49	0	-	-
1.16	ENST00000271715	16	ENSE00001045224	chr1:151381304-151381170	135	POGZ_HUMAN	643-687	45	0	-	-
1.17a	ENST00000271715	17a	ENSE00001045239	chr1:151381057-151380885	173	POGZ_HUMAN	688-745	58	0	-	-
1.17c	ENST00000271715	17c	ENSE00001045241	chr1:151380716-151380576	141	POGZ_HUMAN	745-792	48	0	-	-
1.18b	ENST00000271715	18b	ENSE00001149127	chr1:151379767-151379711	57	POGZ_HUMAN	792-811	20	0	-	-
1.18d	ENST00000271715	18d	ENSE00001149118	chr1:151379499-151379387	113	POGZ_HUMAN	811-849	39	0	-	-
1.18f	ENST00000271715	18f	ENSE00001149109	chr1:151379107-151379083	25	POGZ_HUMAN	849-857	9	0	-	-
1.19f	ENST00000271715	19f	ENSE00001419980	chr1:151378940-151375200	3741	POGZ_HUMAN	857-1410	554	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:49
 aligned with POGZ_HUMAN | Q7Z3K3 from UniProtKB/Swiss-Prot  Length:1410

    Alignment length:93
                                   356       366       376       386       396       406       416       426       436   
           POGZ_HUMAN   347 GSQRTSGPESSMKVTSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQKKGKSLDSEPSVPSAAKPPSPEKTAPVASTPSST 439
               SCOP domains --------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......----------------................hhhhhhhhhhhhh.......----------------------------...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.10a    -----------------------------------Exon 1.12c  PDB: A:396-411 (gaps)            Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.11b  PDB: A:370-395          -------------------------------------------- Transcript 1 (2)
                 2e72 A 363 GSSGSSG----------------QDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQ----------------------------SGPSSG 411
                                  |  -         -   |   376       386       396        |-         -         -       408   
                                369              370                                405                          406

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2E72)

(no "CATH Domain" information available for 2E72)

(no "Pfam Domain" information available for 2E72)

NMR Structure(hide GO term definitions)

Chain A (POGZ_HUMAN | Q7Z3K3)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0051382	kinetochore assembly	The aggregation, arrangement and bonding together of a set of components to form the kinetochore, a multisubunit complex that is located at the centromeric region of DNA and provides an attachment point for the spindle microtubules.
	GO:0007064	mitotic sister chromatid cohesion	The cell cycle process in which the sister chromatids of a replicated chromosome are joined along the entire length of the chromosome, from their formation in S phase through metaphase during a mitotic cell cycle. This cohesion cycle is critical for high fidelity chromosome transmission.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:407 - Pro A:408	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - model 1, sites PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2e72
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	POGZ_HUMAN \| Q7Z3K3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	POGZ_HUMAN \| Q7Z3K3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	POGZ_HUMAN \| Q7Z3K3	:	2n3a

(no "Related Entries Specified in the PDB File" available for 2E72)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (1, 20)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (3, 3)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File