Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE SECOND RNA BINDING DOMAIN IN DAZ-ASSOCIATED PROTEIN 1
 
Authors :  C. Abe, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  15 Mar 06  (Deposition) - 15 Sep 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Rrm Domain, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Rna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Abe, Y. Muto, M. Inoue, T. Terada, T. Kigawa, M. Shirouzu, S. Yokoyama
Solution Structure Of The Second Rna Binding Domain In Daz-Associated Protein 1
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DAZ-ASSOCIATED PROTEIN 1
    ChainsA
    EngineeredYES
    Expression SystemCELL FREE SYNTHESIS
    Expression System PlasmidP051017-03
    Expression System Vector TypePLASMID
    FragmentRNA RECOGNITION MOTIF
    GeneDAZAP1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsCELL-FREE PROTEIN SYNTHESIS
    SynonymDELETED IN AZOOSPERMIA-ASSOCIATED PROTEIN 1

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2DGS)

(-) Sites  (0, 0)

(no "Site" information available for 2DGS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2DGS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2DGS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2DGS)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RRMPS50102 Eukaryotic RNA Recognition Motif (RRM) profile.DAZP1_HUMAN10-97
113-190
  1-
A:113-190

(-) Exons   (5, 5)

NMR Structure (5, 5)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002330781ENSE00001180932chr19:1407584-1407801218DAZP1_HUMAN1-10100--
1.2ENST000002330782ENSE00001266753chr19:1417499-141753941DAZP1_HUMAN10-24150--
1.3ENST000002330783ENSE00001266707chr19:1418203-1418369167DAZP1_HUMAN24-79560--
1.4ENST000002330784ENSE00001266698chr19:1418665-141873066DAZP1_HUMAN80-101221A:103-1053
1.5ENST000002330785ENSE00000336445chr19:1421147-1421257111DAZP1_HUMAN102-138371A:106-138 (gaps)35
1.6ENST000002330786ENSE00000336446chr19:1422347-142239549DAZP1_HUMAN139-155171A:139-15517
1.7ENST000002330787ENSE00000752956chr19:1425877-142595983DAZP1_HUMAN155-182281A:155-18228
1.8ENST000002330788ENSE00000752955chr19:1428841-1428994154DAZP1_HUMAN183-234521A:183-201 (gaps)35
1.9ENST000002330789ENSE00000752954chr19:1429966-142999530DAZP1_HUMAN234-244110--
1.10ENST0000023307810ENSE00000752953chr19:1430221-1430361141DAZP1_HUMAN244-291480--
1.11ENST0000023307811ENSE00000752952chr19:1432513-1432689177DAZP1_HUMAN291-350600--
1.13ENST0000023307813ENSE00001605245chr19:1434736-1435683948DAZP1_HUMAN350-407580--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:99
 aligned with DAZP1_HUMAN | Q96EP5 from UniProtKB/Swiss-Prot  Length:407

    Alignment length:129
                                    98       108       118       128       138       148       158       168       178       188       198       208         
          DAZP1_HUMAN    89 GMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANG 217
               SCOP domains d2d            g  sa_ A: automated matches                                                                                        SCOP domains
               CATH domains 2dg            s  A01 A:103-191  [code=3.30.70.330, no name defined]                                   -------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...------------.--.......eeeee......hhhhhhhhhh....eeeeee...........eeeeee.hhhhhhhhhhhh.........eeee...........----------------... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE RRM      ---------------RRM  PDB: A:113-190 UniProt: 113-190                                          --------------------------- PROSITE
           Transcript 1 (1) Exon 1.4     Exon 1.5  PDB: A:106-138 (gaps)      Exon 1.6         ---------------------------Exon 1.8  PDB: A:183-201 (gaps)     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------Exon 1.7  PDB: A:155-182    ----------------------------------- Transcript 1 (2)
                 2dgs A 103 GSS------------G--SSGSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSSGP----------------SSG 201
                              |      -     | 108       118       128       138       148       158       168       178       188       198         -      |  
                              |          106  |                                                                                        198              199  
                            105             107                                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2DGS)

(-) Gene Ontology  (13, 13)

NMR Structure(hide GO term definitions)
Chain A   (DAZP1_HUMAN | Q96EP5)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0035613    RNA stem-loop binding    Interacting selectively and non-covalently with a stem-loop in an RNA molecule. An RNA stem-loop is a secondary RNA structure consisting of a double-stranded RNA (dsRNA) stem and a terminal loop.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0001893    maternal placenta development    Maternally driven process whose specific outcome is the progression of the placenta over time, from its formation to the mature structure. The placenta is an organ of metabolic interchange between fetus and mother, partly of embryonic origin and partly of maternal origin.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0048026    positive regulation of mRNA splicing, via spliceosome    Any process that activates or increases the rate or extent of mRNA splicing via a spliceosomal mechanism.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2dgs)
 
  Sites
(no "Sites" information available for 2dgs)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2dgs)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2dgs
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DAZP1_HUMAN | Q96EP5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DAZP1_HUMAN | Q96EP5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DAZP1_HUMAN | Q96EP52dh8

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2DGS)