|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2D9Y) |
Sites (0, 0)| (no "Site" information available for 2D9Y) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2D9Y) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2D9Y) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2D9Y) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (4, 4)
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:117 aligned with PKHA6_HUMAN | Q9Y2H5 from UniProtKB/Swiss-Prot Length:1048 Alignment length:121 55 65 75 85 95 105 115 125 135 145 155 165 PKHA6_HUMAN 46 GKRSHSMKRNPNAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQIPPAQK 166 SCOP domains d2d9ya_ A: automated matches SCOP domains CATH domains 2d9yA00 A:1-117 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------PH_DOMAIN PDB: A:10-109 UniProt: 59-158 -------- PROSITE Transcript 1 (1) Exon 1.4 UniProt: 35-69 Exon 1.5 PDB: A:21-45 ---------------------------------Exon 1.8c PDB: A:79-117 [INCOMPLETE] Transcript 1 (1) Transcript 1 (2) ------------------------------------------------Exon 1.6 PDB: A:45-78 --------------------------------------- Transcript 1 (2) 2d9y A 1 GSSGSSG----NAPVTKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESILGSIPLLSFRVAAVQPSDNISRKHTFKAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQSGPSSG 117 | - | 16 26 36 46 56 66 76 86 96 106 116 7 8
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2D9Y) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2D9Y)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|