2D9Q - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE HUMAN GCSF-RECEPTOR SIGNALING COMPLEX

Authors :   T. Tamada, R. Kuroki

Date :   12 Dec 05 (Deposition) - 07 Feb 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (2x)

Keywords :   Cytokine, Ligand-Receptor Complex, Signaling Protein-Cytokine Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Tamada, E. Honjo, Y. Maeda, T. Okamoto, M. Ishibashi, M. Tokunaga, R. Kuroki
Homodimeric Cross-Over Structure Of The Human Granulocyte Colony-Stimulating Factor (Gcsf) Receptor Signaling Complex
Proc. Natl. Acad. Sci. Usa V. 103 3135 2006
PubMed-ID: 16492764 | Reference-DOI: 10.1073/PNAS.0511264103
(for further references see the PDB file header)

Molecule 1 - CSF3
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 1-174
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GRANULOCYTE COLONY STIMULATING FACTOR, GCSF

Molecule 2 - GRANULOCYTE COLONY-STIMULATING FACTOR RECEPTOR
	Chains	:	B
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cell Line	:	SF9
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACUROVIRUS
	Fragment	:	IG-CRH DOMAIN
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	G-CSF-R, CD114 ANTIGEN, GCSF-R

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	NAG	2	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	NAG	4	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN B:111 , THR B:114 , LYS B:203 , GLU B:205 , NAG B:402	BINDING SITE FOR RESIDUE NAG B 401
2	AC2	SOFTWARE	NAG B:401	BINDING SITE FOR RESIDUE NAG B 402

Asymmetric Unit

No.	Residues
1	A:36	-	A:42
2	A:64	-	A:74
3	B:3	-	B:29
4	B:23	-	B:78
5	B:108	-	B:119
6	B:144	-	B:195
7	B:154	-	B:163
8	B:225	-	B:272
9	B:243	-	B:286

(no "Cis Peptide Bond" information available for 2D9Q)

Asymmetric Unit (6, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013073	L	157	M	CSF3_HUMAN	Polymorphism	2227329	A	L	124	M
2	UniProt	VAR_013074	A	174	T	CSF3_HUMAN	Polymorphism	2227330	A	A	141	T
3	UniProt	VAR_062517	P	229	H	CSF3R_HUMAN	Disease	764202764	B	P	206	H
4	UniProt	VAR_014325	M	231	T	CSF3R_HUMAN	Polymorphism	3917973	B	M	208	T
5	UniProt	VAR_077011	R	308	C	CSF3R_HUMAN	Disease (SCN7)	606231473	B	R	285	C
6	UniProt	VAR_014326	D	320	N	CSF3R_HUMAN	Polymorphism	3918018	B	D	297	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (6, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013073	L	157	M	CSF3_HUMAN	Polymorphism	2227329	A	L	124	M
2	UniProt	VAR_013074	A	174	T	CSF3_HUMAN	Polymorphism	2227330	A	A	141	T
3	UniProt	VAR_062517	P	229	H	CSF3R_HUMAN	Disease	764202764	B	P	206	H
4	UniProt	VAR_014325	M	231	T	CSF3R_HUMAN	Polymorphism	3917973	B	M	208	T
5	UniProt	VAR_077011	R	308	C	CSF3R_HUMAN	Disease (SCN7)	606231473	B	R	285	C
6	UniProt	VAR_014326	D	320	N	CSF3R_HUMAN	Polymorphism	3918018	B	D	297	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	INTERLEUKIN_6	PS00254	Interleukin-6 / G-CSF / MGF signature.	CSF3_HUMAN	97-122	1	A:64-89
2	FN3	PS50853	Fibronectin type-III domain profile.	CSF3R_HUMAN	125-230 233-332 334-430 431-528 530-623	2	B:102-207 B:210-308 - - -

Biological Unit 1 (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	INTERLEUKIN_6	PS00254	Interleukin-6 / G-CSF / MGF signature.	CSF3_HUMAN	97-122	2	A:64-89
2	FN3	PS50853	Fibronectin type-III domain profile.	CSF3R_HUMAN	125-230 233-332 334-430 431-528 530-623	4	B:102-207 B:210-308 - - -

Asymmetric Unit (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000225474	1b	ENSE00001309996	chr17:38171697-38171767	71	CSF3_HUMAN	1-14	14	0	-	-
1.1f	ENST00000225474	1f	ENSE00000950689	chr17:38171944-38172107	164	CSF3_HUMAN	14-68	55	1	A:7-35	29
1.2a	ENST00000225474	2a	ENSE00000950690	chr17:38172486-38172593	108	CSF3_HUMAN	69-104	36	1	A:36-71	36
1.2c	ENST00000225474	2c	ENSE00000950691	chr17:38172738-38172884	147	CSF3_HUMAN	105-153	49	1	A:72-120	49
1.3c	ENST00000225474	3c	ENSE00001268721	chr17:38173048-38174066	1019	CSF3_HUMAN	154-207	54	1	A:121-174	54

2.1a	ENST00000373106	1a	ENSE00001459525	chr1:36948879-36948412	468	CSF3R_HUMAN	-	0	0	-	-
2.3	ENST00000373106	3	ENSE00001459523	chr1:36947138-36947079	60	CSF3R_HUMAN	-	0	0	-	-
2.5b	ENST00000373106	5b	ENSE00002182987	chr1:36945117-36945034	84	CSF3R_HUMAN	1-22	22	0	-	-
2.7b	ENST00000373106	7b	ENSE00000807433	chr1:36941274-36940978	297	CSF3R_HUMAN	22-121	100	1	B:3-98	96
2.8a	ENST00000373106	8a	ENSE00000807434	chr1:36939488-36939365	124	CSF3R_HUMAN	121-162	42	1	B:98-139	42
2.9a	ENST00000373106	9a	ENSE00000807435	chr1:36939223-36939036	188	CSF3R_HUMAN	162-225	64	1	B:139-202	64
2.9d	ENST00000373106	9d	ENSE00000807436	chr1:36938287-36938118	170	CSF3R_HUMAN	225-281	57	1	B:202-258 (gaps)	57
2.10a	ENST00000373106	10a	ENSE00000807437	chr1:36937992-36937839	154	CSF3R_HUMAN	282-333	52	1	B:259-308	50
2.11a	ENST00000373106	11a	ENSE00000807438	chr1:36937740-36937667	74	CSF3R_HUMAN	333-357	25	0	-	-
2.11c	ENST00000373106	11c	ENSE00000807439	chr1:36937247-36937034	214	CSF3R_HUMAN	358-429	72	0	-	-
2.12	ENST00000373106	12	ENSE00000807440	chr1:36935441-36935253	189	CSF3R_HUMAN	429-492	64	0	-	-
2.13a	ENST00000373106	13a	ENSE00000807441	chr1:36934858-36934757	102	CSF3R_HUMAN	492-526	35	0	-	-
2.13d	ENST00000373106	13d	ENSE00000807442	chr1:36933822-36933676	147	CSF3R_HUMAN	526-575	50	0	-	-
2.13g	ENST00000373106	13g	ENSE00000807443	chr1:36933563-36933423	141	CSF3R_HUMAN	575-622	48	0	-	-
2.14b	ENST00000373106	14b	ENSE00000807444	chr1:36933252-36933159	94	CSF3R_HUMAN	622-653	32	0	-	-
2.15a	ENST00000373106	15a	ENSE00001715962	chr1:36932912-36932831	82	CSF3R_HUMAN	653-680	28	0	-	-
2.15j	ENST00000373106	15j	ENSE00001633459	chr1:36932428-36931644	785	CSF3R_HUMAN	681-836	156	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:168
 aligned with CSF3_HUMAN | P09919 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:171
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206 
           CSF3_HUMAN    37 SSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 207
               SCOP domains d2d9qa_ A: automated matches                                                                                                                                                SCOP domains
               CATH domains 2d9qA00 A:7-174  [code=1.20.1   250.10, no name defined]                                                                                                                    CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhh---hh.........hhhhhhhhh.................hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh..................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------M----------------T--------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------INTERLEUKIN_6  PDB: A:64-8------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1f  PDB: A:7-35          Exon 1.2a  PDB: A:36-71             Exon 1.2c  PDB: A:72-120 UniProt: 105-153        Exon 1.3c  PDB: A:121-174 UniProt: 154-207             Transcript 1
                 2d9q A   7 SSLPQSFLLKCLEQVRKIQGDGAALQEKL---CATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 174
                                    16        26        |-  |     43        53        63        73        83        93       103       113       123       133       143       153       163       173 
                                                       35  36

Chain B from PDB  Type:PROTEIN  Length:299
 aligned with CSF3R_HUMAN | Q99062 from UniProtKB/Swiss-Prot  Length:836

    Alignment length:306
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325      
          CSF3R_HUMAN    26 CGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPSLELRTTE 331
               SCOP domains d2d9qb1 B:3-96 Granulocyte colony-stimulating factor (GC-SF) receptor, N-terminal domain      d2d9qb3 B:97-203 Granulocyte colony-stimulating factor (GC-SF) receptor                                    d2d9qb2 B:2       04-308 Granulocyte colony-stimulating factor (GC-SF) receptor                           SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------2d9qB02 B:97-204 Immunoglobulins                                                                            2d9qB03 B:       205-308 Immunoglobulins                                                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eee...ee.....eeeee...............eee.........ee.........eeeee......eeeeeeeee....eeeeeeeeeee.......eeeeeeee....eeeeeee.........eeeeeeee...........eeee.......eeeee.hhh.....eeeeeeeee..eeee...eeehhhh.ee....eeee...-------....eeeeee.hhhhh...eeeeeeeee.......eeeeee...eeeeee........eeeeeeeee.............eee.... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H-T----------------------------------------------------------------------------C-----------N----------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------FN3  PDB: B:102-207 UniProt: 125-230                                                                      --FN3  PDB: B:210-308 UniProt: 233-332                                                                PROSITE
           Transcript 2 (1) Exon 2.7b  PDB: B:3-98 UniProt: 22-121 [INCOMPLETE]                                             ----------------------------------------Exon 2.9a  PDB: B:139-202 UniProt: 162-225                      --------------------------------------------------------Exon 2.10a  PDB: B:259-308 UniProt: 282-333        Transcript 2 (1)
           Transcript 2 (2) -----------------------------------------------------------------------------------------------Exon 2.8a  PDB: B:98-139 UniProt: 121-162 --------------------------------------------------------------Exon 2.9d  PDB: B:202-258 (gaps) UniProt: 225-281        -------------------------------------------------- Transcript 2 (2)
                 2d9q B   3 CGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCSLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPKDGQSHCSIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDP-------QAGCLQLSWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPSLELRTTE 308
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212 |     222       232       242       252       262       272       282       292       302      
                                                                                                                                                                                                                                             214     222

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Growth Hormone; Chain: A; (136)

Homologous Superfamily: [code=1.20.1250.10, no name defined] (130)

Human (Homo sapiens) (110)

2d9qA00

A:7-174

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Human (Homo sapiens) (912)

2a	2d9qB02	B:97-204
2b	2d9qB03	B:205-308

(no "Pfam Domain" information available for 2D9Q)

Asymmetric Unit(hide GO term definitions)

Chain A (CSF3_HUMAN | P09919)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0005130	granulocyte colony-stimulating factor receptor binding	Interacting selectively and non-covalently with the granulocyte colony-stimulating factor receptor.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
biological process
	GO:0071345	cellular response to cytokine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0030851	granulocyte differentiation	The process in which a myeloid precursor cell acquires the specialized features of a granulocyte. Granulocytes are a class of leukocytes characterized by the presence of granules in their cytoplasm. These cells are active in allergic immune reactions such as arthritic inflammation and rashes. This class includes basophils, eosinophils and neutrophils.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:1901215	negative regulation of neuron death	Any process that stops, prevents or reduces the frequency, rate or extent of neuron death.
	GO:2000251	positive regulation of actin cytoskeleton reorganization	Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization.
	GO:0030838	positive regulation of actin filament polymerization	Any process that activates or increases the frequency, rate or extent of actin polymerization.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045639	positive regulation of myeloid cell differentiation	Any process that activates or increases the frequency, rate or extent of myeloid cell differentiation.
	GO:0033138	positive regulation of peptidyl-serine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:0051897	positive regulation of protein kinase B signaling	Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
	GO:0042993	positive regulation of transcription factor import into nucleus	Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain B (CSF3R_HUMAN | Q99062)

molecular function
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004872	receptor activity	Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
biological process
	GO:0097186	amelogenesis	The process whose specific outcome is the formation of tooth enamel, occurring in two stages: secretory stage and maturation stage.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0006952	defense response	Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
	GO:0030593	neutrophil chemotaxis	The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
	GO:0045637	regulation of myeloid cell differentiation	Any process that modulates the frequency, rate or extent of myeloid cell differentiation.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2d9q)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2d9q
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CSF3R_HUMAN \| Q99062
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CSF3_HUMAN \| P09919
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	617014
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CSF3R_HUMAN \| Q99062
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CSF3_HUMAN \| P09919
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CSF3R_HUMAN \| Q99062	:	1az7
	CSF3_HUMAN \| P09919	:	1cd9 1gnc 1pgr 1rhg

(no "Related Entries Specified in the PDB File" available for 2D9Q)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (9, 9)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (6, 6)

PROSITE Motifs (2, 3)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 4)

CATH Domains (2, 3)

Pfam Domains (0, 0)

Gene Ontology (37, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File