1CD9 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   2:2 COMPLEX OF G-CSF WITH ITS RECEPTOR

Authors :   M. Aritomi, N. Kunishima, T. Okamoto, R. Kuroki, Y. Ota, K. Morikawa

Date :   08 Mar 99 (Deposition) - 08 Mar 00 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Class1 Cytokine, Hematopoietic Receptor, Signal Transduction, Cytokine (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Aritomi, N. Kunishima, T. Okamoto, R. Kuroki, Y. Ota, K. Morikawa
Atomic Structure Of The Gcsf-Receptor Complex Showing A New Cytokine-Receptor Recognition Scheme.
Nature V. 401 713 1999
PubMed-ID: 10537111 | Reference-DOI: 10.1038/44394

Molecule 1 - PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)
	Cellular Location	:	EXTRACELLULAR
	Chains	:	A, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	G-CSF

Molecule 2 - PROTEIN (G-CSF RECEPTOR)
	Cellular Location	:	CELLULAR MEMBRANE
	Chains	:	B, D
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cellular Location	:	NUCLEUS
	Expression System Cell Line	:	SF-9
	Expression System Common	:	FALL ARMYWORM
	Expression System Taxid	:	7108
	Expression System Vector	:	AUTOGRAPHA CALIFORNICA NUCLEAR POLYHEDROSIS VIRUS
	Expression System Vector Type	:	VIRUS
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Other Details	:	N-LINKED GLYCOSYLATION AT B10
	Synonym	:	G-CSF-R

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	NAG	2	Ligand/Ion	N-ACETYL-D-GLUCOSAMINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASN B:10 , GLN B:25	BINDING SITE FOR RESIDUE NAG B 323
2	AC2	SOFTWARE	ASN D:10 , GLN D:25	BINDING SITE FOR RESIDUE NAG D 923

Asymmetric/Biological Unit

No.	Residues
1	A:37	-	A:43
2	A:65	-	A:75
3	B:13	-	B:24
4	B:49	-	B:100
5	B:59	-	B:68
6	B:130	-	B:177
7	B:148	-	B:191
8	C:37	-	C:43
9	C:65	-	C:75
10	D:13	-	D:24
11	D:49	-	D:100
12	D:59	-	D:68
13	D:130	-	D:177
14	D:148	-	D:191

(no "Cis Peptide Bond" information available for 1CD9)

Asymmetric/Biological Unit (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_013073	L	157	M	CSF3_HUMAN	Polymorphism	2227329	A/C	L	125	M
2	UniProt	VAR_013074	A	174	T	CSF3_HUMAN	Polymorphism	2227330	A/C	A	142	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	INTERLEUKIN_6	PS00254	Interleukin-6 / G-CSF / MGF signature.	CSF3_HUMAN	97-122	2	A:65-90 C:65-90
2	FN3	PS50853	Fibronectin type-III domain profile.	CSF3R_MOUSE	126-231 236-331 434-529 334-433 530-624	4	B:7-112 D:7-112 B:117-212 D:117-212 - - -

Asymmetric/Biological Unit (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000225474	1b	ENSE00001309996	chr17:38171697-38171767	71	CSF3_HUMAN	1-14	14	0	-	-
1.1f	ENST00000225474	1f	ENSE00000950689	chr17:38171944-38172107	164	CSF3_HUMAN	14-68	55	2	A:5-36 C:7-36	32 30
1.2a	ENST00000225474	2a	ENSE00000950690	chr17:38172486-38172593	108	CSF3_HUMAN	69-104	36	2	A:37-72 C:37-72	36 36
1.2c	ENST00000225474	2c	ENSE00000950691	chr17:38172738-38172884	147	CSF3_HUMAN	105-153	49	2	A:73-121 C:73-121	49 49
1.3c	ENST00000225474	3c	ENSE00001268721	chr17:38173048-38174066	1019	CSF3_HUMAN	154-207	54	2	A:122-175 C:122-175	54 54

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:171
 aligned with CSF3_HUMAN | P09919 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:174
                                    43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203    
           CSF3_HUMAN    34 GPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 207
               SCOP domains d1cd9a_ A: Granulocyte-colony st   imulating factor (G-CSF)                                                                                                                    SCOP domains
               CATH domains 1cd9A00 A:5-175  [code=1.20.1250   .10, no name defined]                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhh---hhhh...hhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------M----------------T--------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------INTERLEUKIN_6  PDB: A:65-9------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1f  PDB: A:5-36 [INCOMPLETE]Exon 1.2a  PDB: A:37-72             Exon 1.2c  PDB: A:73-121 UniProt: 105-153        Exon 1.3c  PDB: A:122-175 UniProt: 154-207             Transcript 1
                 1cd9 A   5 GPASSLPQSFLLKCLEQVRKIQGDGAALQEKL---CATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 175
                                    14        24        34 |   |  41        51        61        71        81        91       101       111       121       131       141       151       161       171    
                                                          36  37

Chain B from PDB  Type:PROTEIN  Length:206
 aligned with CSF3R_MOUSE | P40223 from UniProtKB/Swiss-Prot  Length:837

    Alignment length:213
                                   129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329   
          CSF3R_MOUSE   120 AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGPDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM 332
               SCOP domains d1cd9b1 B:1-107 Granulocyte colony-stimulating factor (GC-SF) receptor                                     d1cd9b2 B:10       8-213 Granulocyte colony-stimulating factor (GC-SF) receptor                            SCOP domains
               CATH domains 1cd9B01 B:1-108 Immunoglobulins                                                                             1cd9B02 B:1       09-213 Immunoglobulins                                                                  CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeee....eeeeeee.........eeeeeeee.hhhhh....eeeeee......eeeee.hhh.....eeeeeeeee..eeee...eeehhhhh......eeeee..-------....eeeeee.hhhhh...eeeeeeeee.......eeeeeee..eeeeee........eeeeeeeee.............eee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------FN3  PDB: B:7-112 UniProt: 126-231                                                                        ----FN3  PDB: B:117-212 UniProt: 236-331                                                            - PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cd9 B   1 AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDI-------QPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM 213
                                    10        20        30        40        50        60        70        80        90       100       110        |-      |130       140       150       160       170       180       190       200       210   
                                                                                                                                                119     127

Chain C from PDB  Type:PROTEIN  Length:169
 aligned with CSF3_HUMAN | P09919 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:172
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205  
           CSF3_HUMAN    36 ASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 207
               SCOP domains d1cd9c_ C: Granulocyte-colony    stimulating factor (G-CSF)                                                                                                                  SCOP domains
               CATH domains 1cd9C00 C:7-175  [code=1.20.12   50.10, no name defined]                                                                                                                     CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhh---hhhhh..hhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------M----------------T--------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------INTERLEUKIN_6  PDB: C:65-9------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1f  PDB: C:7-36           Exon 1.2a  PDB: C:37-72             Exon 1.2c  PDB: C:73-121 UniProt: 105-153        Exon 1.3c  PDB: C:122-175 UniProt: 154-207             Transcript 1
                 1cd9 C   7 ASSLPQSFLLKCLEQVRKIQGDGAALQEKL---CATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP 175
                                    16        26        36   |    43        53        63        73        83        93       103       113       123       133       143       153       163       173  
                                                        36  37

Chain D from PDB  Type:PROTEIN  Length:204
 aligned with CSF3R_MOUSE | P40223 from UniProtKB/Swiss-Prot  Length:837

    Alignment length:212
                                   130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330  
          CSF3R_MOUSE   121 GYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIGPDVVSHQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM 332
               SCOP domains d1cd9d1 D:2-107 Granulocyte colony-stimulating factor (GC-SF) receptor                                    d1cd9d2 D:1        08-213 Granulocyte colony-stimulating factor (GC-SF) receptor                           SCOP domains
               CATH domains 1cd9D01 D:2-108 Immunoglobulins                                                                            1cd9D02 D:        109-212 Immunoglobulins                                                               - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeee....eeeeeee..........eeeeeee.hhhhh....eeeeee.........ee.hhh.....eeeeeeeee..eeee...eeehhhhh......eeee..--------...eeeeeee.hhhhh...eeeeeeeee.......eeeeeee..eeeeeee.......eeeeeeeee.................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----FN3  PDB: D:7-112 UniProt: 126-231                                                                        ----FN3  PDB: D:117-212 UniProt: 236-331                                                            - PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1cd9 D   2 GYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALD--------QPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM 213
                                    11        21        31        41        51        61        71        81        91       101       111      |  -     | 131       141       151       161       171       181       191       201       211  
                                                                                                                                              118      127

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: 4-helical cytokines (168)

Superfamily: 4-helical cytokines (168)

Family: Long-chain cytokines (46)

Protein domain: Granulocyte-colony stimulating factor (G-CSF) (7)

Human (Homo sapiens) [TaxId: 9606] (4)

1a	d1cd9a_	A:
1b	d1cd9c_	C:

Class: All beta proteins (24004)

Fold: Immunoglobulin-like beta-sandwich (7299)

Superfamily: Fibronectin type III (212)

Family: Fibronectin type III (180)

Protein domain: Granulocyte colony-stimulating factor (GC-SF) receptor (5)

Mouse (Mus musculus) [TaxId: 10090] (4)

2a	d1cd9b1	B:1-107
2b	d1cd9b2	B:108-213
2c	d1cd9d1	D:2-107
2d	d1cd9d2	D:108-213

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Growth Hormone; Chain: A; (136)

Homologous Superfamily: [code=1.20.1250.10, no name defined] (130)

Human (Homo sapiens) (110)

1a	1cd9C00	C:7-175
1b	1cd9A00	A:5-175

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

Human (Homo sapiens) (912)

2a	1cd9D01	D:2-108
2b	1cd9B01	B:1-108
2c	1cd9B02	B:109-213
2d	1cd9D02	D:109-212

(no "Pfam Domain" information available for 1CD9)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,C (CSF3_HUMAN | P09919)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0005130	granulocyte colony-stimulating factor receptor binding	Interacting selectively and non-covalently with the granulocyte colony-stimulating factor receptor.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
biological process
	GO:0071345	cellular response to cytokine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0030851	granulocyte differentiation	The process in which a myeloid precursor cell acquires the specialized features of a granulocyte. Granulocytes are a class of leukocytes characterized by the presence of granules in their cytoplasm. These cells are active in allergic immune reactions such as arthritic inflammation and rashes. This class includes basophils, eosinophils and neutrophils.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:1901215	negative regulation of neuron death	Any process that stops, prevents or reduces the frequency, rate or extent of neuron death.
	GO:2000251	positive regulation of actin cytoskeleton reorganization	Any process that activates or increases the frequency, rate or extent of actin cytoskeleton reorganization.
	GO:0030838	positive regulation of actin filament polymerization	Any process that activates or increases the frequency, rate or extent of actin polymerization.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0045639	positive regulation of myeloid cell differentiation	Any process that activates or increases the frequency, rate or extent of myeloid cell differentiation.
	GO:0033138	positive regulation of peptidyl-serine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:0051897	positive regulation of protein kinase B signaling	Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
	GO:0042993	positive regulation of transcription factor import into nucleus	Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain B,D (CSF3R_MOUSE | P40223)

molecular function
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0097186	amelogenesis	The process whose specific outcome is the formation of tooth enamel, occurring in two stages: secretory stage and maturation stage.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0030593	neutrophil chemotaxis	The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
	GO:0045637	regulation of myeloid cell differentiation	Any process that modulates the frequency, rate or extent of myeloid cell differentiation.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cd9)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1cd9
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CSF3R_MOUSE \| P40223
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	CSF3_HUMAN \| P09919
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CSF3R_MOUSE \| P40223
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	CSF3_HUMAN \| P09919
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CSF3R_MOUSE \| P40223	:	1cto 1gcf 1pgr
	CSF3_HUMAN \| P09919	:	1gnc 1pgr 1rhg 2d9q

(no "Related Entries Specified in the PDB File" available for 1CD9)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (14, 14)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 4)

PROSITE Motifs (2, 6)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 6)

CATH Domains (2, 6)

Pfam Domains (0, 0)

Gene Ontology (32, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File